Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 37567..38093 | Replicon | plasmid pMB9539_2 |
| Accession | NZ_CP103496 | ||
| Organism | Enterobacter hormaechei strain 70 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | S1EXL1 |
| Locus tag | M5T15_RS23415 | Protein ID | WP_000323025.1 |
| Coordinates | 37806..38093 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | J5W3H0 |
| Locus tag | M5T15_RS23410 | Protein ID | WP_004196370.1 |
| Coordinates | 37567..37806 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T15_RS23375 (32904) | 32904..33096 | - | 193 | Protein_39 | MFS transporter | - |
| M5T15_RS23380 (33126) | 33126..34103 | + | 978 | WP_004196334.1 | chromate resistance protein | - |
| M5T15_RS23385 (34060) | 34060..35436 | + | 1377 | WP_259429925.1 | chromate efflux transporter | - |
| M5T15_RS23390 (35467) | 35467..36156 | - | 690 | WP_004196322.1 | hypothetical protein | - |
| M5T15_RS23395 (36170) | 36170..36907 | - | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
| M5T15_RS23400 (36951) | 36951..37316 | - | 366 | WP_009651956.1 | hypothetical protein | - |
| M5T15_RS23405 (37444) | 37444..37542 | - | 99 | Protein_45 | protein YdfV | - |
| M5T15_RS23410 (37567) | 37567..37806 | + | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
| M5T15_RS23415 (37806) | 37806..38093 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
| M5T15_RS23420 (38165) | 38165..38323 | + | 159 | WP_013087178.1 | type I toxin-antitoxin system Hok family toxin | - |
| M5T15_RS23425 (39202) | 39202..39516 | + | 315 | WP_023338051.1 | hypothetical protein | - |
| M5T15_RS23430 (39576) | 39576..40037 | + | 462 | WP_048974901.1 | DUF1419 domain-containing protein | - |
| M5T15_RS23435 (40127) | 40127..40327 | + | 201 | WP_031494497.1 | hypothetical protein | - |
| M5T15_RS23440 (40368) | 40368..41159 | + | 792 | WP_032663722.1 | N-6 DNA methylase | - |
| M5T15_RS23445 (41202) | 41202..41537 | + | 336 | WP_023345479.1 | hypothetical protein | - |
| M5T15_RS23450 (42227) | 42227..42520 | + | 294 | WP_032663725.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..83861 | 83861 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T255179 WP_000323025.1 NZ_CP103496:37806-38093 [Enterobacter hormaechei]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|