Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4643995..4644611 | Replicon | chromosome |
Accession | NZ_CP103494 | ||
Organism | Enterobacter hormaechei strain 70 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | M5T15_RS22235 | Protein ID | WP_045142560.1 |
Coordinates | 4643995..4644366 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | M5T15_RS22240 | Protein ID | WP_015569912.1 |
Coordinates | 4644369..4644611 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T15_RS22220 (M5T15_22220) | 4641495..4642397 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
M5T15_RS22225 (M5T15_22225) | 4642394..4643029 | + | 636 | WP_003861958.1 | formate dehydrogenase cytochrome b556 subunit | - |
M5T15_RS22230 (M5T15_22230) | 4643026..4643955 | + | 930 | WP_045142561.1 | formate dehydrogenase accessory protein FdhE | - |
M5T15_RS22235 (M5T15_22235) | 4643995..4644366 | - | 372 | WP_045142560.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
M5T15_RS22240 (M5T15_22240) | 4644369..4644611 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
M5T15_RS22245 (M5T15_22245) | 4644810..4645730 | + | 921 | WP_045142559.1 | alpha/beta hydrolase | - |
M5T15_RS22250 (M5T15_22250) | 4645739..4646680 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
M5T15_RS22255 (M5T15_22255) | 4646725..4647162 | - | 438 | WP_015569909.1 | D-aminoacyl-tRNA deacylase | - |
M5T15_RS22260 (M5T15_22260) | 4647159..4648040 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
M5T15_RS22265 (M5T15_22265) | 4648034..4648633 | - | 600 | WP_003861947.1 | glucose-1-phosphatase | - |
M5T15_RS22270 (M5T15_22270) | 4648752..4649552 | - | 801 | WP_045142558.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13716.82 Da Isoelectric Point: 6.6419
>T255178 WP_045142560.1 NZ_CP103494:c4644366-4643995 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRRGHEAKTAAVMGAFEIIDVSRDIAERSVSLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRVEAADAIEHTASHRAISLITWMEVMVGARRRGHEAKTAAVMGAFEIIDVSRDIAERSVSLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|