Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3779916..3780573 | Replicon | chromosome |
Accession | NZ_CP103494 | ||
Organism | Enterobacter hormaechei strain 70 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | A0A179PSF7 |
Locus tag | M5T15_RS18050 | Protein ID | WP_017382887.1 |
Coordinates | 3779916..3780326 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | G8LDB7 |
Locus tag | M5T15_RS18055 | Protein ID | WP_003863437.1 |
Coordinates | 3780307..3780573 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T15_RS18030 (M5T15_18030) | 3775914..3777647 | - | 1734 | WP_045141946.1 | single-stranded-DNA-specific exonuclease RecJ | - |
M5T15_RS18035 (M5T15_18035) | 3777653..3778366 | - | 714 | WP_003863443.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
M5T15_RS18040 (M5T15_18040) | 3778395..3779291 | - | 897 | WP_259429675.1 | site-specific tyrosine recombinase XerD | - |
M5T15_RS18045 (M5T15_18045) | 3779393..3779914 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
M5T15_RS18050 (M5T15_18050) | 3779916..3780326 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
M5T15_RS18055 (M5T15_18055) | 3780307..3780573 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
M5T15_RS18060 (M5T15_18060) | 3780868..3781848 | + | 981 | WP_017382888.1 | tRNA-modifying protein YgfZ | - |
M5T15_RS18065 (M5T15_18065) | 3781960..3782619 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
M5T15_RS18070 (M5T15_18070) | 3782886..3783617 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
M5T15_RS18075 (M5T15_18075) | 3783734..3785167 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T255177 WP_017382887.1 NZ_CP103494:c3780326-3779916 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A179PSF7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837F8P5 |