Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2359485..2360224 | Replicon | chromosome |
Accession | NZ_CP103494 | ||
Organism | Enterobacter hormaechei strain 70 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
Locus tag | M5T15_RS11400 | Protein ID | WP_003857133.1 |
Coordinates | 2359485..2359970 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | M5T15_RS11405 | Protein ID | WP_003857131.1 |
Coordinates | 2359958..2360224 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T15_RS11365 (M5T15_11365) | 2354762..2355520 | - | 759 | WP_045142134.1 | trans-aconitate 2-methyltransferase | - |
M5T15_RS11370 (M5T15_11370) | 2355605..2356189 | - | 585 | WP_045142135.1 | GDP-mannose pyrophosphatase | - |
M5T15_RS11375 (M5T15_11375) | 2356276..2357034 | + | 759 | WP_045142136.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
M5T15_RS11380 (M5T15_11380) | 2357139..2357459 | + | 321 | WP_045142137.1 | hypothetical protein | - |
M5T15_RS11385 (M5T15_11385) | 2357479..2357622 | + | 144 | WP_227789192.1 | hypothetical protein | - |
M5T15_RS11390 (M5T15_11390) | 2357884..2358849 | + | 966 | WP_032648329.1 | hypothetical protein | - |
M5T15_RS11395 (M5T15_11395) | 2358865..2359434 | + | 570 | WP_032648331.1 | hypothetical protein | - |
M5T15_RS11400 (M5T15_11400) | 2359485..2359970 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
M5T15_RS11405 (M5T15_11405) | 2359958..2360224 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
M5T15_RS11410 (M5T15_11410) | 2360288..2361217 | - | 930 | WP_045142163.1 | LysR family transcriptional regulator | - |
M5T15_RS11415 (M5T15_11415) | 2361347..2362735 | + | 1389 | WP_045142139.1 | MFS transporter | - |
M5T15_RS11420 (M5T15_11420) | 2362757..2363752 | - | 996 | WP_015570513.1 | DUF2891 domain-containing protein | - |
M5T15_RS11425 (M5T15_11425) | 2363762..2364748 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T255171 WP_003857133.1 NZ_CP103494:c2359970-2359485 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L9PBP9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |