Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 1759807..1760604 | Replicon | chromosome |
Accession | NZ_CP103494 | ||
Organism | Enterobacter hormaechei strain 70 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | - |
Locus tag | M5T15_RS08365 | Protein ID | WP_045141441.1 |
Coordinates | 1760083..1760604 (+) | Length | 174 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | F5RT92 |
Locus tag | M5T15_RS08360 | Protein ID | WP_001303459.1 |
Coordinates | 1759807..1760076 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T15_RS08325 (M5T15_08325) | 1755347..1755706 | + | 360 | WP_017384779.1 | helix-turn-helix domain-containing protein | - |
M5T15_RS08330 (M5T15_08330) | 1755785..1755880 | - | 96 | Protein_1616 | transcriptional regulator | - |
M5T15_RS08335 (M5T15_08335) | 1756033..1757274 | + | 1242 | WP_017693667.1 | bifunctional glucose-1-phosphatase/inositol phosphatase | - |
M5T15_RS08340 (M5T15_08340) | 1757307..1757534 | - | 228 | WP_006809324.1 | YccJ family protein | - |
M5T15_RS08345 (M5T15_08345) | 1757553..1758149 | - | 597 | WP_006809323.1 | NAD(P)H:quinone oxidoreductase | - |
M5T15_RS08350 (M5T15_08350) | 1758541..1758711 | + | 171 | WP_001273664.1 | general stress protein | - |
M5T15_RS08355 (M5T15_08355) | 1758828..1759733 | + | 906 | WP_045141440.1 | DMT family transporter | - |
M5T15_RS08360 (M5T15_08360) | 1759807..1760076 | + | 270 | WP_001303459.1 | DUF1778 domain-containing protein | Antitoxin |
M5T15_RS08365 (M5T15_08365) | 1760083..1760604 | + | 522 | WP_045141441.1 | GNAT family N-acetyltransferase | Toxin |
M5T15_RS08370 (M5T15_08370) | 1760663..1761985 | - | 1323 | WP_045141442.1 | pyrimidine utilization transport protein G | - |
M5T15_RS08375 (M5T15_08375) | 1762007..1762498 | - | 492 | WP_045141443.1 | pyrimidine utilization flavin reductase protein F | - |
M5T15_RS08380 (M5T15_08380) | 1762511..1763101 | - | 591 | WP_045141444.1 | malonic semialdehyde reductase | - |
M5T15_RS08385 (M5T15_08385) | 1763111..1763911 | - | 801 | WP_039271149.1 | pyrimidine utilization protein D | - |
M5T15_RS08390 (M5T15_08390) | 1763919..1764305 | - | 387 | WP_015570870.1 | pyrimidine utilization protein C | - |
M5T15_RS08395 (M5T15_08395) | 1764317..1765006 | - | 690 | WP_045141445.1 | pyrimidine utilization protein B | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19407.16 Da Isoelectric Point: 7.4318
>T255170 WP_045141441.1 NZ_CP103494:1760083-1760604 [Enterobacter hormaechei]
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTEHLVRQHGGRILRGYLLKERDHPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTALVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
VANLTIEMLSEGTDYDFGDFDCGEPSLNAFLTEHLVRQHGGRILRGYLLKERDHPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVTLGRLAVHKELQGNEWGTALVTHAMRVVYLASQAVGVHGIFVDALNERAKRFYLKLGFIPLAGENSSSLF
FPTQSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|