Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 341938..342534 | Replicon | chromosome |
| Accession | NZ_CP103494 | ||
| Organism | Enterobacter hormaechei strain 70 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A7G3EX93 |
| Locus tag | M5T15_RS01635 | Protein ID | WP_015570164.1 |
| Coordinates | 342232..342534 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A927HL08 |
| Locus tag | M5T15_RS01630 | Protein ID | WP_023295755.1 |
| Coordinates | 341938..342225 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T15_RS01625 (M5T15_01625) | 340310..341941 | + | 1632 | WP_003860350.1 | Na/Pi cotransporter family protein | - |
| M5T15_RS01630 (M5T15_01630) | 341938..342225 | - | 288 | WP_023295755.1 | putative addiction module antidote protein | Antitoxin |
| M5T15_RS01635 (M5T15_01635) | 342232..342534 | - | 303 | WP_015570164.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| M5T15_RS01640 (M5T15_01640) | 342732..343604 | + | 873 | WP_003860347.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| M5T15_RS01645 (M5T15_01645) | 343605..343877 | - | 273 | WP_017382612.1 | DUF3811 domain-containing protein | - |
| M5T15_RS01650 (M5T15_01650) | 343928..344872 | - | 945 | WP_015570166.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| M5T15_RS01655 (M5T15_01655) | 344966..346315 | - | 1350 | WP_006810501.1 | lysine-sensitive aspartokinase 3 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11425.18 Da Isoelectric Point: 10.3736
>T255167 WP_015570164.1 NZ_CP103494:c342534-342232 [Enterobacter hormaechei]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNSIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDIRPVGEGISELRIHFGPGYRIYFKDQGNSIIVLLCGGDKS
SQARDILMAKMLSNVSQWQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|