Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 109855..110574 | Replicon | chromosome |
Accession | NZ_CP103494 | ||
Organism | Enterobacter hormaechei strain 70 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | M5T15_RS00530 | Protein ID | WP_040117033.1 |
Coordinates | 109855..110175 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | M5T15_RS00535 | Protein ID | WP_032620726.1 |
Coordinates | 110209..110574 (-) | Length | 122 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T15_RS00510 (M5T15_00510) | 105824..106165 | - | 342 | WP_006812446.1 | SymE family type I addiction module toxin | - |
M5T15_RS00515 (M5T15_00515) | 106294..106455 | + | 162 | WP_065419814.1 | YlcI/YnfO family protein | - |
M5T15_RS00520 (M5T15_00520) | 106640..107380 | + | 741 | WP_063151591.1 | hypothetical protein | - |
M5T15_RS00525 (M5T15_00525) | 107377..109662 | + | 2286 | WP_062934147.1 | DEAD/DEAH box helicase | - |
M5T15_RS00530 (M5T15_00530) | 109855..110175 | - | 321 | WP_040117033.1 | TA system toxin CbtA family protein | Toxin |
M5T15_RS00535 (M5T15_00535) | 110209..110574 | - | 366 | WP_032620726.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
M5T15_RS00540 (M5T15_00540) | 110606..110827 | - | 222 | WP_032620724.1 | DUF987 domain-containing protein | - |
M5T15_RS00545 (M5T15_00545) | 110836..111306 | - | 471 | WP_040117034.1 | DNA repair protein RadC | - |
M5T15_RS00550 (M5T15_00550) | 111376..112197 | - | 822 | WP_032620720.1 | DUF932 domain-containing protein | - |
M5T15_RS00555 (M5T15_00555) | 112890..113729 | - | 840 | WP_049125417.1 | hypothetical protein | - |
M5T15_RS00560 (M5T15_00560) | 113842..114276 | - | 435 | WP_044488933.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 101849..136597 | 34748 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12206.77 Da Isoelectric Point: 5.9558
>T255166 WP_040117033.1 NZ_CP103494:c110175-109855 [Enterobacter hormaechei]
MHISTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVHRAQYNLGLKRS
MHISTVPATVTVSSRLSPVQVWQKLLTYILEHHYGLTINDTPFSNDTTIQEHIEAGVNLTDAVNFLVERFELVRIDQKGF
SWQDQEPWITSLDVHRAQYNLGLKRS
Download Length: 321 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13574.29 Da Isoelectric Point: 6.4673
>AT255166 WP_032620726.1 NZ_CP103494:c110574-110209 [Enterobacter hormaechei]
MQSTTISGTSAENTSCLQWELKRNITPCFGARLVQESNRLYFLADRAGFNGSFSDDEALRLDQAFPLMMKQLERMLTAGE
LDPRSQHCVTRHHNGLTCEADTLGSHGYVYIAIYPQSALTR
MQSTTISGTSAENTSCLQWELKRNITPCFGARLVQESNRLYFLADRAGFNGSFSDDEALRLDQAFPLMMKQLERMLTAGE
LDPRSQHCVTRHHNGLTCEADTLGSHGYVYIAIYPQSALTR
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|