Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 98009..98534 Replicon plasmid pMB9544_1
Accession NZ_CP103488
Organism Klebsiella quasipneumoniae subsp. quasipneumoniae strain 5463

Toxin (Protein)


Gene name ccdB Uniprot ID W8UQV6
Locus tag M5T26_RS26465 Protein ID WP_001568026.1
Coordinates 98229..98534 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag M5T26_RS26460 Protein ID WP_001568025.1
Coordinates 98009..98227 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T26_RS26430 (M5T26_26430) 93646..94170 - 525 Protein_108 IS5-like element ISKpn26 family transposase -
M5T26_RS26435 (M5T26_26435) 94206..95645 - 1440 Protein_109 IS66 family transposase -
M5T26_RS26440 (M5T26_26440) 95710..96414 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
M5T26_RS26445 (M5T26_26445) 96500..96640 + 141 WP_045286941.1 helix-turn-helix domain-containing protein -
M5T26_RS26450 (M5T26_26450) 96738..97154 - 417 WP_021312768.1 type II toxin-antitoxin system VapC family toxin -
M5T26_RS26455 (M5T26_26455) 97151..97381 - 231 WP_021312767.1 type II toxin-antitoxin system VapB family antitoxin -
M5T26_RS26460 (M5T26_26460) 98009..98227 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
M5T26_RS26465 (M5T26_26465) 98229..98534 + 306 WP_001568026.1 type II toxin-antitoxin system toxin CcdB Toxin
M5T26_RS26470 (M5T26_26470) 98692..99375 + 684 WP_023280892.1 hypothetical protein -
M5T26_RS26475 (M5T26_26475) 99378..100154 + 777 WP_049245386.1 site-specific integrase -
M5T26_RS26480 (M5T26_26480) 100212..100469 - 258 WP_000764642.1 hypothetical protein -
M5T26_RS26485 (M5T26_26485) 100598..100702 - 105 WP_032409716.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sul1 / qacE / dfrA1 / blaDHA-1 / qnrB4 - 1..101380 101380


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11645.32 Da        Isoelectric Point: 5.6919

>T255165 WP_001568026.1 NZ_CP103488:98229-98534 [Klebsiella quasipneumoniae subsp. quasipneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASAWLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT255165 WP_001568025.1 NZ_CP103488:98009-98227 [Klebsiella quasipneumoniae subsp. quasipneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A514EZN1

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References