Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4805101..4805572 | Replicon | chromosome |
Accession | NZ_CP103487 | ||
Organism | Klebsiella quasipneumoniae subsp. quasipneumoniae strain 5463 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | M5T26_RS23330 | Protein ID | WP_023291758.1 |
Coordinates | 4805101..4805340 (-) | Length | 80 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A1C1EW86 |
Locus tag | M5T26_RS23335 | Protein ID | WP_023291757.1 |
Coordinates | 4805330..4805572 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T26_RS23320 (4802054) | 4802054..4804192 | + | 2139 | WP_004206513.1 | anaerobic ribonucleoside-triphosphate reductase | - |
M5T26_RS23325 (4804588) | 4804588..4805052 | + | 465 | WP_012969085.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
M5T26_RS23330 (4805101) | 4805101..4805340 | - | 240 | WP_023291758.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T26_RS23335 (4805330) | 4805330..4805572 | - | 243 | WP_023291757.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
M5T26_RS23340 (4805650) | 4805650..4807560 | - | 1911 | WP_044525201.1 | PRD domain-containing protein | - |
M5T26_RS23345 (4807583) | 4807583..4808734 | - | 1152 | WP_023291755.1 | lactonase family protein | - |
M5T26_RS23350 (4808801) | 4808801..4809541 | - | 741 | WP_017900574.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 80 a.a. Molecular weight: 9162.72 Da Isoelectric Point: 10.1315
>T255163 WP_023291758.1 NZ_CP103487:c4805340-4805101 [Klebsiella quasipneumoniae subsp. quasipneumoniae]
MTYELAFDPRAWREWQKLGETIKKQFKNKLQQVVQNPRIASASLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIG
MTYELAFDPRAWREWQKLGETIKKQFKNKLQQVVQNPRIASASLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIG
Download Length: 240 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|