Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 791095..791752 | Replicon | chromosome |
| Accession | NZ_CP103487 | ||
| Organism | Klebsiella quasipneumoniae subsp. quasipneumoniae strain 5463 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A2N4VX63 |
| Locus tag | M5T26_RS03920 | Protein ID | WP_023290968.1 |
| Coordinates | 791342..791752 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | M5T26_RS03915 | Protein ID | WP_002916312.1 |
| Coordinates | 791095..791361 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T26_RS03890 (786245) | 786245..787678 | - | 1434 | WP_064158015.1 | 6-phospho-beta-glucosidase | - |
| M5T26_RS03895 (787797) | 787797..788525 | - | 729 | WP_032454033.1 | MurR/RpiR family transcriptional regulator | - |
| M5T26_RS03900 (788576) | 788576..788887 | + | 312 | WP_064158016.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5T26_RS03905 (789051) | 789051..789710 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| M5T26_RS03910 (789866) | 789866..790849 | - | 984 | WP_064158017.1 | tRNA-modifying protein YgfZ | - |
| M5T26_RS03915 (791095) | 791095..791361 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| M5T26_RS03920 (791342) | 791342..791752 | + | 411 | WP_023290968.1 | protein YgfX | Toxin |
| M5T26_RS03925 (791759) | 791759..792280 | - | 522 | WP_004205324.1 | flavodoxin FldB | - |
| M5T26_RS03930 (792381) | 792381..793277 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
| M5T26_RS03935 (793300) | 793300..794013 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5T26_RS03940 (794019) | 794019..795752 | + | 1734 | WP_032454029.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16075.89 Da Isoelectric Point: 11.4778
>T255156 WP_023290968.1 NZ_CP103487:791342-791752 [Klebsiella quasipneumoniae subsp. quasipneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDPGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2N4VX63 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |