Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4591606..4592201 | Replicon | chromosome |
| Accession | NZ_CP103479 | ||
| Organism | Escherichia coli strain 4621 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | V0SXT4 |
| Locus tag | M5T46_RS21820 | Protein ID | WP_000239581.1 |
| Coordinates | 4591606..4591956 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | V0YZQ7 |
| Locus tag | M5T46_RS21825 | Protein ID | WP_001223206.1 |
| Coordinates | 4591950..4592201 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T46_RS21800 (4587051) | 4587051..4588073 | - | 1023 | WP_024176215.1 | ABC transporter permease | - |
| M5T46_RS21805 (4588087) | 4588087..4589589 | - | 1503 | WP_001095668.1 | sugar ABC transporter ATP-binding protein | - |
| M5T46_RS21810 (4589731) | 4589731..4590687 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| M5T46_RS21815 (4590997) | 4590997..4591527 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| M5T46_RS21820 (4591606) | 4591606..4591956 | - | 351 | WP_000239581.1 | endoribonuclease toxin ChpB | Toxin |
| M5T46_RS21825 (4591950) | 4591950..4592201 | - | 252 | WP_001223206.1 | type II toxin-antitoxin system ChpS family antitoxin | Antitoxin |
| M5T46_RS21830 (4592413) | 4592413..4592754 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| M5T46_RS21835 (4592757) | 4592757..4596536 | - | 3780 | WP_000060869.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12453.41 Da Isoelectric Point: 6.2206
>T255145 WP_000239581.1 NZ_CP103479:c4591956-4591606 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAAGEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|