Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) ykfI-yeeU/CbtA-CbeA
Location 4468953..4469660 Replicon chromosome
Accession NZ_CP103479
Organism Escherichia coli strain 4621

Toxin (Protein)


Gene name ykfI Uniprot ID V0YJ99
Locus tag M5T46_RS21255 Protein ID WP_000691792.1
Coordinates 4468953..4469294 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID V0YMY8
Locus tag M5T46_RS21260 Protein ID WP_000939436.1
Coordinates 4469325..4469660 (-) Length 112 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T46_RS21225 (4464363) 4464363..4465343 + 981 WP_000991420.1 sialate O-acetylesterase -
M5T46_RS21230 (4465351) 4465351..4466001 - 651 WP_001037973.1 HNH endonuclease -
M5T46_RS21235 (4466138) 4466138..4466281 + 144 Protein_4159 HNH endonuclease -
M5T46_RS21240 (4466603) 4466603..4467550 - 948 WP_000342498.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M5T46_RS21245 (4467543) 4467543..4467938 - 396 WP_000152741.1 DUF6088 family protein -
M5T46_RS21250 (4468008) 4468008..4468841 - 834 WP_001192747.1 DUF4942 domain-containing protein -
M5T46_RS21255 (4468953) 4468953..4469294 - 342 WP_000691792.1 TA system toxin CbtA family protein Toxin
M5T46_RS21260 (4469325) 4469325..4469660 - 336 WP_000939436.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T46_RS21265 (4469660) 4469660..4470133 - 474 WP_001292743.1 DNA repair protein RadC -
M5T46_RS21270 (4470163) 4470163..4470981 - 819 WP_001046747.1 DUF932 domain-containing protein -
M5T46_RS21275 (4471218) 4471218..4472171 - 954 WP_000290408.1 hypothetical protein -
M5T46_RS21280 (4472763) 4472763..4473377 + 615 WP_000772910.1 inovirus Gp2 family protein -
M5T46_RS21285 (4473495) 4473495..4473713 + 219 WP_000070772.1 AlpA family phage regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - fimC / fimI / fimA / fimE / fimB 4456927..4486423 29496


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-110)

Antitoxin

Antitoxin CbeA

(10-110)


Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13064.12 Da        Isoelectric Point: 9.8743

>T255143 WP_000691792.1 NZ_CP103479:c4469294-4468953 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLTRLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVDAVNFLVEKYELIRIDRKGF
SWKEQTPYLRAVDILRARQATGLLRRCHNTTAR

Download         Length: 342 bp

Antitoxin


Download         Length: 112 a.a.        Molecular weight: 12582.53 Da        Isoelectric Point: 7.2122

>AT255143 WP_000939436.1 NZ_CP103479:c4469660-4469325 [Escherichia coli]
MLQKDKVMQQEWGLPCTVTPRFTARLVQERHNLHYLADRAAITGKFSSPDLLHIDQAFPVLMKQLELKLADGELSPCQQR
TVTLYAKELTCEADTLGSSGYVYIAIYPAQR

Download         Length: 336 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0YJ99

Antitoxin

Source ID Structure
AlphaFold DB V0YMY8

References