Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3841832..3842450 | Replicon | chromosome |
| Accession | NZ_CP103479 | ||
| Organism | Escherichia coli strain 4621 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | M5T46_RS18355 | Protein ID | WP_001291435.1 |
| Coordinates | 3842232..3842450 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | M5T46_RS18350 | Protein ID | WP_000344800.1 |
| Coordinates | 3841832..3842206 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T46_RS18340 (3836921) | 3836921..3838114 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| M5T46_RS18345 (3838137) | 3838137..3841286 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| M5T46_RS18350 (3841832) | 3841832..3842206 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| M5T46_RS18355 (3842232) | 3842232..3842450 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| M5T46_RS18360 (3842622) | 3842622..3843173 | + | 552 | WP_000102573.1 | maltose O-acetyltransferase | - |
| M5T46_RS18365 (3843289) | 3843289..3843759 | + | 471 | WP_001328420.1 | YlaC family protein | - |
| M5T46_RS18370 (3843923) | 3843923..3845473 | + | 1551 | WP_001445674.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| M5T46_RS18375 (3845515) | 3845515..3845868 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| M5T46_RS18385 (3846247) | 3846247..3846558 | + | 312 | WP_000409905.1 | MGMT family protein | - |
| M5T46_RS18390 (3846589) | 3846589..3847161 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255138 WP_001291435.1 NZ_CP103479:3842232-3842450 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255138 WP_000344800.1 NZ_CP103479:3841832-3842206 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |