Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3418298..3419003 | Replicon | chromosome |
Accession | NZ_CP103479 | ||
Organism | Escherichia coli strain 4621 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M5T46_RS16500 | Protein ID | WP_000539521.1 |
Coordinates | 3418298..3418684 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5T46_RS16505 | Protein ID | WP_001280945.1 |
Coordinates | 3418674..3419003 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T46_RS16480 (3414302) | 3414302..3414928 | + | 627 | WP_001328219.1 | glutathione S-transferase GstB | - |
M5T46_RS16485 (3414925) | 3414925..3416040 | - | 1116 | WP_000555049.1 | aldose sugar dehydrogenase YliI | - |
M5T46_RS16490 (3416151) | 3416151..3416534 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M5T46_RS16495 (3416747) | 3416747..3418072 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M5T46_RS16500 (3418298) | 3418298..3418684 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T46_RS16505 (3418674) | 3418674..3419003 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M5T46_RS16510 (3419073) | 3419073..3420401 | - | 1329 | WP_000086868.1 | GGDEF domain-containing protein | - |
M5T46_RS16515 (3420409) | 3420409..3422757 | - | 2349 | WP_001328220.1 | EAL domain-containing protein | - |
M5T46_RS16520 (3422935) | 3422935..3423846 | - | 912 | WP_001236018.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T255137 WP_000539521.1 NZ_CP103479:3418298-3418684 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|