Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2734652..2735290 | Replicon | chromosome |
| Accession | NZ_CP103479 | ||
| Organism | Escherichia coli strain 4621 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | B7N4J4 |
| Locus tag | M5T46_RS13075 | Protein ID | WP_000813797.1 |
| Coordinates | 2735114..2735290 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | M5T46_RS13070 | Protein ID | WP_001270286.1 |
| Coordinates | 2734652..2735068 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T46_RS13050 (2729804) | 2729804..2730745 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| M5T46_RS13055 (2730746) | 2730746..2731759 | - | 1014 | WP_000220398.1 | ABC transporter ATP-binding protein | - |
| M5T46_RS13060 (2731777) | 2731777..2732922 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| M5T46_RS13065 (2733167) | 2733167..2734573 | - | 1407 | WP_000760596.1 | PLP-dependent aminotransferase family protein | - |
| M5T46_RS13070 (2734652) | 2734652..2735068 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| M5T46_RS13075 (2735114) | 2735114..2735290 | - | 177 | WP_000813797.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| M5T46_RS13080 (2735512) | 2735512..2735742 | + | 231 | WP_000491976.1 | YncJ family protein | - |
| M5T46_RS13085 (2735834) | 2735834..2737795 | - | 1962 | WP_001445698.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| M5T46_RS13090 (2737868) | 2737868..2738404 | - | 537 | WP_000429505.1 | DNA-binding transcriptional regulator SutR | - |
| M5T46_RS13095 (2738496) | 2738496..2739668 | + | 1173 | WP_001236217.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6724.76 Da Isoelectric Point: 11.5666
>T255136 WP_000813797.1 NZ_CP103479:c2735290-2735114 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFQGRRSVMPRHPSDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT255136 WP_001270286.1 NZ_CP103479:c2735068-2734652 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|