Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1223664..1224247 | Replicon | chromosome |
Accession | NZ_CP103479 | ||
Organism | Escherichia coli strain 4621 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | M5T46_RS05940 | Protein ID | WP_000254738.1 |
Coordinates | 1223912..1224247 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | M5T46_RS05935 | Protein ID | WP_000581937.1 |
Coordinates | 1223664..1223912 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T46_RS05925 (1220003) | 1220003..1221304 | + | 1302 | WP_000046787.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
M5T46_RS05930 (1221352) | 1221352..1223586 | + | 2235 | WP_000226798.1 | GTP diphosphokinase | - |
M5T46_RS05935 (1223664) | 1223664..1223912 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
M5T46_RS05940 (1223912) | 1223912..1224247 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
M5T46_RS05945 (1224319) | 1224319..1225110 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
M5T46_RS05950 (1225338) | 1225338..1226975 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
M5T46_RS05955 (1227063) | 1227063..1228361 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T255129 WP_000254738.1 NZ_CP103479:1223912-1224247 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|