Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 1072155..1072809 | Replicon | chromosome |
| Accession | NZ_CP103479 | ||
| Organism | Escherichia coli strain 4621 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | M5T46_RS05255 | Protein ID | WP_000244781.1 |
| Coordinates | 1072402..1072809 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | M5T46_RS05250 | Protein ID | WP_000354046.1 |
| Coordinates | 1072155..1072421 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5T46_RS05230 (1068243) | 1068243..1069676 | - | 1434 | WP_001559758.1 | 6-phospho-beta-glucosidase BglA | - |
| M5T46_RS05235 (1069721) | 1069721..1070032 | + | 312 | WP_001182957.1 | N(4)-acetylcytidine aminohydrolase | - |
| M5T46_RS05240 (1070196) | 1070196..1070855 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| M5T46_RS05245 (1070932) | 1070932..1071912 | - | 981 | WP_000886086.1 | tRNA-modifying protein YgfZ | - |
| M5T46_RS05250 (1072155) | 1072155..1072421 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| M5T46_RS05255 (1072402) | 1072402..1072809 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| M5T46_RS05260 (1072849) | 1072849..1073370 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| M5T46_RS05265 (1073482) | 1073482..1074378 | + | 897 | WP_000806652.1 | site-specific tyrosine recombinase XerD | - |
| M5T46_RS05270 (1074403) | 1074403..1075113 | + | 711 | WP_000715213.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| M5T46_RS05275 (1075119) | 1075119..1076852 | + | 1734 | WP_000813226.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T255128 WP_000244781.1 NZ_CP103479:1072402-1072809 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|