Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
| Location | 63057..63658 | Replicon | plasmid pMB9698_1 |
| Accession | NZ_CP103469 | ||
| Organism | Escherichia coli strain 4973 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | M5S50_RS25365 | Protein ID | WP_001216031.1 |
| Coordinates | 63057..63437 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | U9YQH9 |
| Locus tag | M5S50_RS25370 | Protein ID | WP_001190712.1 |
| Coordinates | 63437..63658 (-) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S50_RS25340 (M5S50_25335) | 58497..59981 | - | 1485 | WP_000124159.1 | hypothetical protein | - |
| M5S50_RS25345 (M5S50_25340) | 59981..61174 | - | 1194 | WP_000219605.1 | terminase | - |
| M5S50_RS25350 (M5S50_25345) | 61261..61713 | - | 453 | WP_001312282.1 | late promoter-activating protein (Gp10) | - |
| M5S50_RS25355 (M5S50_25350) | 61802..62845 | - | 1044 | WP_259423635.1 | DUF968 domain-containing protein | - |
| M5S50_RS25360 (M5S50_25355) | 62873..63052 | - | 180 | WP_001411052.1 | hypothetical protein | - |
| M5S50_RS25365 (M5S50_25360) | 63057..63437 | - | 381 | WP_001216031.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| M5S50_RS25370 (M5S50_25365) | 63437..63658 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| M5S50_RS25375 (M5S50_25370) | 63731..64120 | - | 390 | WP_000506726.1 | S24 family peptidase | - |
| M5S50_RS25380 (M5S50_25375) | 64244..64495 | - | 252 | WP_001283837.1 | DNA polymerase III subunit theta | - |
| M5S50_RS25385 (M5S50_25380) | 64528..64878 | + | 351 | WP_000551789.1 | hypothetical protein | - |
| M5S50_RS25390 (M5S50_25385) | 64863..65147 | - | 285 | WP_001142394.1 | hypothetical protein | - |
| M5S50_RS25395 (M5S50_25390) | 65131..65781 | - | 651 | WP_000057452.1 | hypothetical protein | - |
| M5S50_RS25400 (M5S50_25395) | 65763..66137 | - | 375 | WP_000988651.1 | hypothetical protein | - |
| M5S50_RS25405 (M5S50_25400) | 66144..66437 | - | 294 | WP_000268000.1 | hypothetical protein | - |
| M5S50_RS25410 (M5S50_25405) | 66616..66849 | - | 234 | WP_000517420.1 | hypothetical protein | - |
| M5S50_RS25415 (M5S50_25410) | 66926..67186 | - | 261 | WP_000969527.1 | hypothetical protein | - |
| M5S50_RS25420 (M5S50_25415) | 67183..67929 | - | 747 | WP_259423643.1 | DUF551 domain-containing protein | - |
| M5S50_RS25425 (M5S50_25420) | 67975..68103 | - | 129 | Protein_78 | hypothetical protein | - |
| M5S50_RS25430 (M5S50_25425) | 68100..68309 | - | 210 | WP_005025300.1 | hypothetical protein | - |
| M5S50_RS25435 (M5S50_25430) | 68311..68499 | - | 189 | WP_000797276.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..96268 | 96268 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13557.28 Da Isoelectric Point: 5.6343
>T255118 WP_001216031.1 NZ_CP103469:c63437-63057 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEASATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSTVAATLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEASATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSTVAATLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|