Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4232148..4232698 Replicon chromosome
Accession NZ_CP103468
Organism Escherichia coli strain 4973

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag M5S50_RS20495 Protein ID WP_001160966.1
Coordinates 4232148..4232462 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID S1NMQ0
Locus tag M5S50_RS20500 Protein ID WP_000125568.1
Coordinates 4232465..4232698 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S50_RS20470 (4227823) 4227823..4229109 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
M5S50_RS20475 (4229109) 4229109..4230098 + 990 WP_000241224.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
M5S50_RS20480 (4230095) 4230095..4230916 + 822 WP_001065381.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
M5S50_RS20485 (4230919) 4230919..4231296 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
M5S50_RS20490 (4231303) 4231303..4232151 + 849 WP_000257195.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
M5S50_RS20495 (4232148) 4232148..4232462 - 315 WP_001160966.1 CcdB family protein Toxin
M5S50_RS20500 (4232465) 4232465..4232698 - 234 WP_000125568.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
M5S50_RS20505 (4232784) 4232784..4233263 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
M5S50_RS20510 (4233454) 4233454..4235316 - 1863 WP_022645165.1 glutathione-regulated potassium-efflux system protein KefC -
M5S50_RS20515 (4235309) 4235309..4235839 - 531 WP_000600732.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
M5S50_RS20520 (4235947) 4235947..4237278 - 1332 WP_001183201.1 MFS transporter -
M5S50_RS20525 (4237336) 4237336..4237623 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T255112 WP_001160966.1 NZ_CP103468:c4232462-4232148 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8560.55 Da        Isoelectric Point: 5.8062

>AT255112 WP_000125568.1 NZ_CP103468:c4232698-4232465 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENTEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A829GEF2

References