Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-HTH_XRE |
Location | 3356110..3356815 | Replicon | chromosome |
Accession | NZ_CP103468 | ||
Organism | Escherichia coli strain 4973 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1F406 |
Locus tag | M5S50_RS16155 | Protein ID | WP_000539521.1 |
Coordinates | 3356110..3356496 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | M5S50_RS16160 | Protein ID | WP_001280945.1 |
Coordinates | 3356486..3356815 (+) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5S50_RS16135 (3352114) | 3352114..3352740 | + | 627 | WP_001295292.1 | glutathione S-transferase GstB | - |
M5S50_RS16140 (3352737) | 3352737..3353852 | - | 1116 | WP_000554964.1 | aldose sugar dehydrogenase YliI | - |
M5S50_RS16145 (3353963) | 3353963..3354346 | - | 384 | WP_000497137.1 | biofilm formation regulator BssR | - |
M5S50_RS16150 (3354559) | 3354559..3355884 | + | 1326 | WP_000049367.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
M5S50_RS16155 (3356110) | 3356110..3356496 | + | 387 | WP_000539521.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5S50_RS16160 (3356486) | 3356486..3356815 | + | 330 | WP_001280945.1 | DNA-binding transcriptional regulator | Antitoxin |
M5S50_RS16165 (3356885) | 3356885..3358213 | - | 1329 | WP_022645414.1 | GGDEF domain-containing protein | - |
M5S50_RS16170 (3358221) | 3358221..3360569 | - | 2349 | WP_022645413.1 | EAL domain-containing protein | - |
M5S50_RS16175 (3360746) | 3360746..3361657 | - | 912 | WP_001236044.1 | glutathione ABC transporter permease GsiD | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14293.45 Da Isoelectric Point: 9.9296
>T255108 WP_000539521.1 NZ_CP103468:3356110-3356496 [Escherichia coli]
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
MGVYKARRFSQSTKKLGIHDKVLMAAAEEVMQGIWEADLGSGVIKKRLPLQQGKSGGARTIIFFKSANHVFFYDGWSKSG
LSSKGTKEIEDDELAAYKKMANAFLAFSNKQIEDLIETGFLIEVKNER
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|