Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 844377..845212 | Replicon | chromosome |
| Accession | NZ_CP103468 | ||
| Organism | Escherichia coli strain 4973 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0A1A9A5 |
| Locus tag | M5S50_RS04005 | Protein ID | WP_001564063.1 |
| Coordinates | 844377..844754 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0A1AEL8 |
| Locus tag | M5S50_RS04010 | Protein ID | WP_038432125.1 |
| Coordinates | 844844..845212 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| M5S50_RS03975 (839505) | 839505..840653 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| M5S50_RS03980 (840725) | 840725..841708 | - | 984 | WP_001361242.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| M5S50_RS03985 (842519) | 842519..842689 | - | 171 | Protein_783 | IS110 family transposase | - |
| M5S50_RS03990 (843031) | 843031..843873 | - | 843 | Protein_784 | DUF4942 domain-containing protein | - |
| M5S50_RS03995 (843958) | 843958..844152 | - | 195 | WP_024181941.1 | DUF957 domain-containing protein | - |
| M5S50_RS04000 (844231) | 844231..844380 | - | 150 | Protein_786 | DUF5983 family protein | - |
| M5S50_RS04005 (844377) | 844377..844754 | - | 378 | WP_001564063.1 | TA system toxin CbtA family protein | Toxin |
| M5S50_RS04010 (844844) | 844844..845212 | - | 369 | WP_038432125.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| M5S50_RS04015 (845375) | 845375..845596 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| M5S50_RS04020 (845661) | 845661..846137 | - | 477 | WP_021553055.1 | RadC family protein | - |
| M5S50_RS04025 (846153) | 846153..846632 | - | 480 | WP_001564060.1 | antirestriction protein | - |
| M5S50_RS04030 (846898) | 846898..847716 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| M5S50_RS04035 (847806) | 847806..848039 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| M5S50_RS04040 (848045) | 848045..848722 | - | 678 | WP_001564058.1 | hypothetical protein | - |
| M5S50_RS04045 (848873) | 848873..849553 | - | 681 | WP_001278649.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | papX | 842904..908198 | 65294 | |
| - | flank | IS/Tn | - | - | 842519..842674 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14094.09 Da Isoelectric Point: 7.8045
>T255099 WP_001564063.1 NZ_CP103468:c844754-844377 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13569.31 Da Isoelectric Point: 7.0369
>AT255099 WP_038432125.1 NZ_CP103468:c845212-844844 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1A9A5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0A1AEL8 |