Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 844377..845212 Replicon chromosome
Accession NZ_CP103468
Organism Escherichia coli strain 4973

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0A1A9A5
Locus tag M5S50_RS04005 Protein ID WP_001564063.1
Coordinates 844377..844754 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0A1AEL8
Locus tag M5S50_RS04010 Protein ID WP_038432125.1
Coordinates 844844..845212 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5S50_RS03975 (839505) 839505..840653 - 1149 WP_000905920.1 capsule polysaccharide export inner-membrane protein KpsE -
M5S50_RS03980 (840725) 840725..841708 - 984 WP_001361242.1 KpsF/GutQ family sugar-phosphate isomerase -
M5S50_RS03985 (842519) 842519..842689 - 171 Protein_783 IS110 family transposase -
M5S50_RS03990 (843031) 843031..843873 - 843 Protein_784 DUF4942 domain-containing protein -
M5S50_RS03995 (843958) 843958..844152 - 195 WP_024181941.1 DUF957 domain-containing protein -
M5S50_RS04000 (844231) 844231..844380 - 150 Protein_786 DUF5983 family protein -
M5S50_RS04005 (844377) 844377..844754 - 378 WP_001564063.1 TA system toxin CbtA family protein Toxin
M5S50_RS04010 (844844) 844844..845212 - 369 WP_038432125.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5S50_RS04015 (845375) 845375..845596 - 222 WP_000692345.1 DUF987 domain-containing protein -
M5S50_RS04020 (845661) 845661..846137 - 477 WP_021553055.1 RadC family protein -
M5S50_RS04025 (846153) 846153..846632 - 480 WP_001564060.1 antirestriction protein -
M5S50_RS04030 (846898) 846898..847716 - 819 WP_001175165.1 DUF932 domain-containing protein -
M5S50_RS04035 (847806) 847806..848039 - 234 WP_001278293.1 DUF905 family protein -
M5S50_RS04040 (848045) 848045..848722 - 678 WP_001564058.1 hypothetical protein -
M5S50_RS04045 (848873) 848873..849553 - 681 WP_001278649.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - papX 842904..908198 65294
- flank IS/Tn - - 842519..842674 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14094.09 Da        Isoelectric Point: 7.8045

>T255099 WP_001564063.1 NZ_CP103468:c844754-844377 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRSNYRTVNNITRGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13569.31 Da        Isoelectric Point: 7.0369

>AT255099 WP_038432125.1 NZ_CP103468:c845212-844844 [Escherichia coli]
VSDTLSGTTHPDDNHDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGNRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSGGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0A1A9A5

Antitoxin

Source ID Structure
AlphaFold DB A0A0A1AEL8

References