Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 109965..110566 | Replicon | plasmid pMB9877_1 |
Accession | NZ_CP103466 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 5392 |
Toxin (Protein)
Gene name | doc | Uniprot ID | V0AJ64 |
Locus tag | M5T42_RS23820 | Protein ID | WP_001216034.1 |
Coordinates | 109965..110345 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | M5T42_RS23825 | Protein ID | WP_001190712.1 |
Coordinates | 110345..110566 (-) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T42_RS23785 (105016) | 105016..105948 | - | 933 | WP_000081352.1 | homocysteine S-methyltransferase | - |
M5T42_RS23790 (105935) | 105935..107338 | - | 1404 | WP_001373486.1 | S-methylmethionine permease | - |
M5T42_RS23795 (107582) | 107582..108562 | + | 981 | WP_000019407.1 | IS5-like element IS5 family transposase | - |
M5T42_RS23800 (108772) | 108772..109107 | + | 336 | WP_169329198.1 | type I deoxyribonuclease HsdR | - |
M5T42_RS23805 (109057) | 109057..109470 | - | 414 | Protein_127 | integrase core domain-containing protein | - |
M5T42_RS23810 (109475) | 109475..109753 | - | 279 | Protein_128 | pdcB | - |
M5T42_RS23815 (109781) | 109781..109960 | - | 180 | WP_001513661.1 | hypothetical protein | - |
M5T42_RS23820 (109965) | 109965..110345 | - | 381 | WP_001216034.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
M5T42_RS23825 (110345) | 110345..110566 | - | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
M5T42_RS23830 (110749) | 110749..112305 | + | 1557 | WP_001617892.1 | type I restriction-modification system subunit M | - |
M5T42_RS23835 (112302) | 112302..113573 | + | 1272 | WP_023142242.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 | senB | 1..122603 | 122603 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13615.32 Da Isoelectric Point: 5.1514
>T255096 WP_001216034.1 NZ_CP103466:c110345-109965 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0AJ64 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |