255096

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 109965..110566 Replicon plasmid pMB9877_1
Accession NZ_CP103466
Organism Escherichia coli O25b:H4-ST131 strain 5392

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag M5T42_RS23820 Protein ID WP_001216034.1
Coordinates 109965..110345 (-) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag M5T42_RS23825 Protein ID WP_001190712.1
Coordinates 110345..110566 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T42_RS23785 (105016) 105016..105948 - 933 WP_000081352.1 homocysteine S-methyltransferase -
M5T42_RS23790 (105935) 105935..107338 - 1404 WP_001373486.1 S-methylmethionine permease -
M5T42_RS23795 (107582) 107582..108562 + 981 WP_000019407.1 IS5-like element IS5 family transposase -
M5T42_RS23800 (108772) 108772..109107 + 336 WP_169329198.1 type I deoxyribonuclease HsdR -
M5T42_RS23805 (109057) 109057..109470 - 414 Protein_127 integrase core domain-containing protein -
M5T42_RS23810 (109475) 109475..109753 - 279 Protein_128 pdcB -
M5T42_RS23815 (109781) 109781..109960 - 180 WP_001513661.1 hypothetical protein -
M5T42_RS23820 (109965) 109965..110345 - 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
M5T42_RS23825 (110345) 110345..110566 - 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
M5T42_RS23830 (110749) 110749..112305 + 1557 WP_001617892.1 type I restriction-modification system subunit M -
M5T42_RS23835 (112302) 112302..113573 + 1272 WP_023142242.1 restriction endonuclease subunit S -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid blaCTX-M-27 / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 senB 1..122603 122603


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T255096 WP_001216034.1 NZ_CP103466:c110345-109965 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT255096 WP_001190712.1 NZ_CP103466:c110566-110345 [Escherichia coli O25b:H4-ST131]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References