Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3502785..3503403 | Replicon | chromosome |
Accession | NZ_CP103465 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 5392 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | M5T42_RS17020 | Protein ID | WP_001291435.1 |
Coordinates | 3503185..3503403 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | M5T42_RS17015 | Protein ID | WP_000344800.1 |
Coordinates | 3502785..3503159 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T42_RS17005 (3497874) | 3497874..3499067 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
M5T42_RS17010 (3499090) | 3499090..3502239 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
M5T42_RS17015 (3502785) | 3502785..3503159 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
M5T42_RS17020 (3503185) | 3503185..3503403 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
M5T42_RS17025 (3503576) | 3503576..3504127 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
M5T42_RS17030 (3504243) | 3504243..3504713 | + | 471 | WP_000136192.1 | YlaC family protein | - |
M5T42_RS17035 (3504877) | 3504877..3506427 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
M5T42_RS17040 (3506469) | 3506469..3506822 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
M5T42_RS17050 (3507201) | 3507201..3507512 | + | 312 | WP_000409908.1 | MGMT family protein | - |
M5T42_RS17055 (3507543) | 3507543..3508115 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T255086 WP_001291435.1 NZ_CP103465:3503185-3503403 [Escherichia coli O25b:H4-ST131]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT255086 WP_000344800.1 NZ_CP103465:3502785-3503159 [Escherichia coli O25b:H4-ST131]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |