Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | paaR-paaA-parE/- |
Location | 2833389..2833860 | Replicon | chromosome |
Accession | NZ_CP103465 | ||
Organism | Escherichia coli O25b:H4-ST131 strain 5392 |
Toxin (Protein)
Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
Locus tag | M5T42_RS13770 | Protein ID | WP_001303511.1 |
Coordinates | 2833582..2833860 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | paaA | Uniprot ID | Q8XAD5 |
Locus tag | M5T42_RS13765 | Protein ID | WP_001302048.1 |
Coordinates | 2833389..2833580 (+) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
M5T42_RS13720 (2828638) | 2828638..2828856 | - | 219 | WP_001610644.1 | DUF4014 family protein | - |
M5T42_RS13725 (2828889) | 2828889..2829101 | - | 213 | WP_000072553.1 | hypothetical protein | - |
M5T42_RS13730 (2829207) | 2829207..2829629 | - | 423 | Protein_2695 | DUF977 family protein | - |
M5T42_RS13735 (2829645) | 2829645..2830415 | - | 771 | WP_000450998.1 | DUF1627 domain-containing protein | - |
M5T42_RS13740 (2830437) | 2830437..2831183 | - | 747 | WP_000788950.1 | ATP-binding protein | - |
M5T42_RS13745 (2831190) | 2831190..2832152 | - | 963 | WP_000095673.1 | helix-turn-helix domain-containing protein | - |
M5T42_RS13750 (2832175) | 2832175..2832600 | - | 426 | WP_000693943.1 | toxin YdaT family protein | - |
M5T42_RS13755 (2832597) | 2832597..2832899 | - | 303 | WP_001556930.1 | transcriptional regulator | - |
M5T42_RS13760 (2832997) | 2832997..2833368 | + | 372 | WP_001169687.1 | hypothetical protein | - |
M5T42_RS13765 (2833389) | 2833389..2833580 | + | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
M5T42_RS13770 (2833582) | 2833582..2833860 | + | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
M5T42_RS13775 (2834151) | 2834151..2834303 | + | 153 | WP_000380313.1 | DUF1391 family protein | - |
M5T42_RS13780 (2834315) | 2834315..2834653 | + | 339 | WP_000394541.1 | hypothetical protein | - |
M5T42_RS13785 (2834642) | 2834642..2834836 | - | 195 | WP_001295058.1 | hypothetical protein | - |
M5T42_RS13790 (2835412) | 2835412..2835600 | + | 189 | WP_000449175.1 | cell division inhibition protein DicB | - |
M5T42_RS13795 (2835597) | 2835597..2835785 | + | 189 | WP_000199475.1 | DUF1482 family protein | - |
M5T42_RS13800 (2835878) | 2835878..2838316 | + | 2439 | WP_000102132.1 | exonuclease | - |
M5T42_RS13805 (2838378) | 2838378..2838647 | + | 270 | WP_000003742.1 | excisionase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2786900..2846902 | 60002 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T255084 WP_001303511.1 NZ_CP103465:2833582-2833860 [Escherichia coli O25b:H4-ST131]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|