Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 804910..805744 Replicon chromosome
Accession NZ_CP103465
Organism Escherichia coli O25b:H4-ST131 strain 5392

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag M5T42_RS03925 Protein ID WP_000854690.1
Coordinates 804910..805287 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag M5T42_RS03930 Protein ID WP_001305076.1
Coordinates 805376..805744 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
M5T42_RS03895 (801290) 801290..801460 - 171 Protein_765 IS110 family transposase -
M5T42_RS03900 (801931) 801931..802824 - 894 WP_001114681.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
M5T42_RS03905 (802817) 802817..803212 - 396 WP_000208383.1 DUF6088 family protein -
M5T42_RS03910 (803281) 803281..804126 - 846 WP_001529401.1 DUF4942 domain-containing protein -
M5T42_RS03915 (804211) 804211..804408 - 198 WP_000839293.1 DUF957 domain-containing protein -
M5T42_RS03920 (804425) 804425..804913 - 489 WP_000761699.1 DUF5983 family protein -
M5T42_RS03925 (804910) 804910..805287 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
M5T42_RS03930 (805376) 805376..805744 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
M5T42_RS03935 (805794) 805794..806438 - 645 WP_000094916.1 hypothetical protein -
M5T42_RS03940 (806457) 806457..806678 - 222 WP_000692329.1 DUF987 domain-containing protein -
M5T42_RS03945 (806741) 806741..807217 - 477 WP_001186726.1 RadC family protein -
M5T42_RS03950 (807233) 807233..807718 - 486 WP_000849565.1 antirestriction protein -
M5T42_RS03955 (807773) 807773..808591 - 819 WP_001234620.1 DUF932 domain-containing protein -
M5T42_RS03960 (808692) 808692..808925 - 234 WP_000902034.1 DUF905 family protein -
M5T42_RS03965 (809004) 809004..809459 - 456 WP_000581502.1 IrmA family protein -
M5T42_RS03970 (809535) 809535..810662 - 1128 Protein_780 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 785830..853956 68126
- flank IS/Tn - - 801290..801445 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T255075 WP_000854690.1 NZ_CP103465:c805287-804910 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT255075 WP_001305076.1 NZ_CP103465:c805744-805376 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References