Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 3611007..3611643 | Replicon | chromosome |
Accession | NZ_CP103456 | ||
Organism | Bacillus subtilis strain PN176 (HK176) |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NX050_RS19435 | Protein ID | WP_003156187.1 |
Coordinates | 3611007..3611357 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NX050_RS19440 | Protein ID | WP_003225183.1 |
Coordinates | 3611362..3611643 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX050_RS19395 (NX050_19395) | 3606043..3606642 | - | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
NX050_RS19400 (NX050_19400) | 3606642..3607430 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
NX050_RS19405 (NX050_19405) | 3607396..3607878 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
NX050_RS19410 (NX050_19410) | 3607875..3608204 | - | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
NX050_RS19415 (NX050_19415) | 3608273..3609280 | - | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
NX050_RS19420 (NX050_19420) | 3609292..3609693 | - | 402 | WP_014478899.1 | serine/threonine-protein kinase RsbT | - |
NX050_RS19425 (NX050_19425) | 3609697..3610062 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NX050_RS19430 (NX050_19430) | 3610067..3610891 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
NX050_RS19435 (NX050_19435) | 3611007..3611357 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NX050_RS19440 (NX050_19440) | 3611362..3611643 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NX050_RS19445 (NX050_19445) | 3611759..3612928 | - | 1170 | WP_014478898.1 | alanine racemase | - |
NX050_RS19450 (NX050_19450) | 3613043..3614059 | - | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
NX050_RS19455 (NX050_19455) | 3614225..3614590 | - | 366 | WP_014478897.1 | holo-ACP synthase | - |
NX050_RS19460 (NX050_19460) | 3614685..3615284 | + | 600 | WP_014478896.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T255069 WP_003156187.1 NZ_CP103456:c3611357-3611007 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|