Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 2759620..2760536 | Replicon | chromosome |
Accession | NZ_CP103456 | ||
Organism | Bacillus subtilis strain PN176 (HK176) |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NX050_RS14815 | Protein ID | WP_003244695.1 |
Coordinates | 2759620..2760366 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NX050_RS14820 | Protein ID | WP_003232646.1 |
Coordinates | 2760366..2760536 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX050_RS14790 (NX050_14790) | 2754744..2754839 | - | 96 | Protein_2919 | hypothetical protein | - |
NX050_RS14795 (NX050_14795) | 2754948..2755898 | - | 951 | WP_014479571.1 | ring-cleaving dioxygenase | - |
NX050_RS14800 (NX050_14800) | 2756287..2757603 | + | 1317 | WP_014479570.1 | serine/threonine exchanger | - |
NX050_RS14805 (NX050_14805) | 2757879..2758496 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NX050_RS14810 (NX050_14810) | 2758509..2759510 | + | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
NX050_RS14815 (NX050_14815) | 2759620..2760366 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NX050_RS14820 (NX050_14820) | 2760366..2760536 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NX050_RS14825 (NX050_14825) | 2760622..2760759 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NX050_RS14830 (NX050_14830) | 2760797..2761690 | - | 894 | WP_014479567.1 | N-acetylmuramoyl-L-alanine amidase | - |
NX050_RS14835 (NX050_14835) | 2761703..2761966 | - | 264 | WP_014479566.1 | phage holin | - |
NX050_RS14840 (NX050_14840) | 2761979..2762248 | - | 270 | WP_014479565.1 | hemolysin XhlA family protein | - |
NX050_RS14845 (NX050_14845) | 2762301..2763140 | - | 840 | WP_014479564.1 | phage-like element PBSX protein XepA | - |
NX050_RS14850 (NX050_14850) | 2763187..2763351 | - | 165 | WP_014479563.1 | XkdX family protein | - |
NX050_RS14855 (NX050_14855) | 2763348..2763677 | - | 330 | WP_014479562.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T255068 WP_003244695.1 NZ_CP103456:2759620-2760366 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|