Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 3911159..3911675 Replicon chromosome
Accession NZ_CP103450
Organism Erwinia pyrifoliae strain CP201179

Toxin (Protein)


Gene name relE Uniprot ID D2T7S6
Locus tag NYP81_RS18290 Protein ID WP_012669379.1
Coordinates 3911159..3911443 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D2T7S5
Locus tag NYP81_RS18295 Protein ID WP_012669378.1
Coordinates 3911433..3911675 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYP81_RS18260 (NYP81_18260) 3908699..3909097 + 399 WP_012667452.1 helix-turn-helix transcriptional regulator -
NYP81_RS18265 (NYP81_18265) 3909172..3909474 + 303 WP_012667453.1 SymE family type I addiction module toxin -
NYP81_RS18270 (NYP81_18270) 3909539..3909808 - 270 WP_012667454.1 hypothetical protein -
NYP81_RS18275 (NYP81_18275) 3909823..3910287 - 465 WP_012669371.1 Rhs family protein, fragment -
NYP81_RS18280 (NYP81_18280) 3910319..3910534 - 216 WP_259818778.1 hypothetical protein -
NYP81_RS18285 (NYP81_18285) 3910537..3910797 - 261 WP_259818776.1 hypothetical protein -
NYP81_RS18290 (NYP81_18290) 3911159..3911443 - 285 WP_012669379.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NYP81_RS18295 (NYP81_18295) 3911433..3911675 - 243 WP_012669378.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NYP81_RS18300 (NYP81_18300) 3911936..3912991 - 1056 WP_259818775.1 site-specific tyrosine recombinase XerC -
NYP81_RS18305 (NYP81_18305) 3913190..3915886 - 2697 WP_259819201.1 CHC2 zinc finger domain-containing protein -
NYP81_RS18310 (NYP81_18310) 3915984..3916382 + 399 WP_012667452.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3904651..3935980 31329


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-82)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11123.03 Da        Isoelectric Point: 10.3769

>T255067 WP_012669379.1 NZ_CP103450:c3911443-3911159 [Erwinia pyrifoliae]
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9070.45 Da        Isoelectric Point: 4.6310

>AT255067 WP_012669378.1 NZ_CP103450:c3911675-3911433 [Erwinia pyrifoliae]
MATLNVRLDDKLKSKAYAVLDELDVSPTEAVRLLFQYIAENERLPLKTLTVSDEEDALLKTVRERLASPQKGIRVTLDEL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D2T7S6

Antitoxin

Source ID Structure
AlphaFold DB D2T7S5

References