Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 3911159..3911675 | Replicon | chromosome |
Accession | NZ_CP103450 | ||
Organism | Erwinia pyrifoliae strain CP201179 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D2T7S6 |
Locus tag | NYP81_RS18290 | Protein ID | WP_012669379.1 |
Coordinates | 3911159..3911443 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D2T7S5 |
Locus tag | NYP81_RS18295 | Protein ID | WP_012669378.1 |
Coordinates | 3911433..3911675 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP81_RS18260 (NYP81_18260) | 3908699..3909097 | + | 399 | WP_012667452.1 | helix-turn-helix transcriptional regulator | - |
NYP81_RS18265 (NYP81_18265) | 3909172..3909474 | + | 303 | WP_012667453.1 | SymE family type I addiction module toxin | - |
NYP81_RS18270 (NYP81_18270) | 3909539..3909808 | - | 270 | WP_012667454.1 | hypothetical protein | - |
NYP81_RS18275 (NYP81_18275) | 3909823..3910287 | - | 465 | WP_012669371.1 | Rhs family protein, fragment | - |
NYP81_RS18280 (NYP81_18280) | 3910319..3910534 | - | 216 | WP_259818778.1 | hypothetical protein | - |
NYP81_RS18285 (NYP81_18285) | 3910537..3910797 | - | 261 | WP_259818776.1 | hypothetical protein | - |
NYP81_RS18290 (NYP81_18290) | 3911159..3911443 | - | 285 | WP_012669379.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYP81_RS18295 (NYP81_18295) | 3911433..3911675 | - | 243 | WP_012669378.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NYP81_RS18300 (NYP81_18300) | 3911936..3912991 | - | 1056 | WP_259818775.1 | site-specific tyrosine recombinase XerC | - |
NYP81_RS18305 (NYP81_18305) | 3913190..3915886 | - | 2697 | WP_259819201.1 | CHC2 zinc finger domain-containing protein | - |
NYP81_RS18310 (NYP81_18310) | 3915984..3916382 | + | 399 | WP_012667452.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3904651..3935980 | 31329 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11123.03 Da Isoelectric Point: 10.3769
>T255067 WP_012669379.1 NZ_CP103450:c3911443-3911159 [Erwinia pyrifoliae]
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|