Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 3903874..3904390 Replicon chromosome
Accession NZ_CP103450
Organism Erwinia pyrifoliae strain CP201179

Toxin (Protein)


Gene name relE Uniprot ID D2T7S6
Locus tag NYP81_RS18240 Protein ID WP_012669379.1
Coordinates 3903874..3904158 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D2T7S5
Locus tag NYP81_RS18245 Protein ID WP_012669378.1
Coordinates 3904148..3904390 (-) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYP81_RS18210 (NYP81_18210) 3898903..3900297 + 1395 WP_014538497.1 diaminobutyrate--2-oxoglutarate transaminase -
NYP81_RS18215 (NYP81_18215) 3900302..3901774 + 1473 WP_012666821.1 aspartate aminotransferase family protein -
NYP81_RS18220 (NYP81_18220) 3901880..3902124 + 245 Protein_3519 type I toxin-antitoxin system SymE family toxin -
NYP81_RS18225 (NYP81_18225) 3902188..3902592 - 405 WP_041474085.1 hypothetical protein -
NYP81_RS18230 (NYP81_18230) 3902594..3903019 - 426 WP_259819194.1 HNH/endonuclease VII fold putative polymorphic toxin -
NYP81_RS18235 (NYP81_18235) 3903494..3903631 + 138 WP_259819196.1 hypothetical protein -
NYP81_RS18240 (NYP81_18240) 3903874..3904158 - 285 WP_012669379.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NYP81_RS18245 (NYP81_18245) 3904148..3904390 - 243 WP_012669378.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NYP81_RS18250 (NYP81_18250) 3904651..3905706 - 1056 WP_259819198.1 site-specific tyrosine recombinase XerC -
NYP81_RS18255 (NYP81_18255) 3905905..3908601 - 2697 WP_259819200.1 CHC2 zinc finger domain-containing protein -
NYP81_RS18260 (NYP81_18260) 3908699..3909097 + 399 WP_012667452.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-82)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11123.03 Da        Isoelectric Point: 10.3769

>T255066 WP_012669379.1 NZ_CP103450:c3904158-3903874 [Erwinia pyrifoliae]
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9070.45 Da        Isoelectric Point: 4.6310

>AT255066 WP_012669378.1 NZ_CP103450:c3904390-3904148 [Erwinia pyrifoliae]
MATLNVRLDDKLKSKAYAVLDELDVSPTEAVRLLFQYIAENERLPLKTLTVSDEEDALLKTVRERLASPQKGIRVTLDEL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D2T7S6

Antitoxin

Source ID Structure
AlphaFold DB D2T7S5

References