Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2373536..2374052 | Replicon | chromosome |
Accession | NZ_CP103450 | ||
Organism | Erwinia pyrifoliae strain CP201179 |
Toxin (Protein)
Gene name | relE | Uniprot ID | D2T7S6 |
Locus tag | NYP81_RS11365 | Protein ID | WP_012669379.1 |
Coordinates | 2373536..2373820 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | D2T7S5 |
Locus tag | NYP81_RS11370 | Protein ID | WP_012669378.1 |
Coordinates | 2373810..2374052 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP81_RS11340 (NYP81_11340) | 2370025..2370294 | + | 270 | WP_259820067.1 | type I toxin-antitoxin system SymE family toxin | - |
NYP81_RS11345 (NYP81_11345) | 2370355..2370786 | - | 432 | WP_012667206.1 | hypothetical protein | - |
NYP81_RS11350 (NYP81_11350) | 2370788..2371045 | - | 258 | WP_259820069.1 | HNH/ENDO VII family nuclease | - |
NYP81_RS11355 (NYP81_11355) | 2371317..2371577 | - | 261 | WP_259818784.1 | hypothetical protein | - |
NYP81_RS11360 (NYP81_11360) | 2371780..2372915 | + | 1136 | WP_104945024.1 | IS3 family transposase | - |
NYP81_RS11365 (NYP81_11365) | 2373536..2373820 | - | 285 | WP_012669379.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NYP81_RS11370 (NYP81_11370) | 2373810..2374052 | - | 243 | WP_012669378.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NYP81_RS11375 (NYP81_11375) | 2374313..2375368 | - | 1056 | WP_259818775.1 | site-specific tyrosine recombinase XerC | - |
NYP81_RS11380 (NYP81_11380) | 2375567..2378260 | - | 2694 | WP_259818825.1 | CHC2 zinc finger domain-containing protein | - |
NYP81_RS11385 (NYP81_11385) | 2378358..2378756 | + | 399 | WP_259818826.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11123.03 Da Isoelectric Point: 10.3769
>T255064 WP_012669379.1 NZ_CP103450:c2373820-2373536 [Erwinia pyrifoliae]
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|