Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 2074359..2074875 | Replicon | chromosome |
| Accession | NZ_CP103450 | ||
| Organism | Erwinia pyrifoliae strain CP201179 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | D2T7S6 |
| Locus tag | NYP81_RS09980 | Protein ID | WP_012669379.1 |
| Coordinates | 2074591..2074875 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | D2T7S5 |
| Locus tag | NYP81_RS09975 | Protein ID | WP_012669378.1 |
| Coordinates | 2074359..2074601 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP81_RS09960 (NYP81_09960) | 2069688..2070056 | - | 369 | WP_259818773.1 | helix-turn-helix transcriptional regulator | - |
| NYP81_RS09965 (NYP81_09965) | 2070157..2072844 | + | 2688 | WP_259818781.1 | CHC2 zinc finger domain-containing protein | - |
| NYP81_RS09970 (NYP81_09970) | 2073043..2074098 | + | 1056 | WP_259818775.1 | site-specific tyrosine recombinase XerC | - |
| NYP81_RS09975 (NYP81_09975) | 2074359..2074601 | + | 243 | WP_012669378.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| NYP81_RS09980 (NYP81_09980) | 2074591..2074875 | + | 285 | WP_012669379.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NYP81_RS09990 (NYP81_09990) | 2076834..2077094 | + | 261 | WP_259818784.1 | hypothetical protein | - |
| NYP81_RS09995 (NYP81_09995) | 2077141..2077611 | + | 471 | WP_259818785.1 | hypothetical protein | - |
| NYP81_RS10000 (NYP81_10000) | 2077613..2077969 | + | 357 | WP_259817771.1 | hypothetical protein | - |
| NYP81_RS10005 (NYP81_10005) | 2078037..2078339 | - | 303 | WP_259817772.1 | type I toxin-antitoxin system SymE family toxin | - |
| NYP81_RS10010 (NYP81_10010) | 2078414..2078818 | - | 405 | WP_259817774.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2062222..2093004 | 30782 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11123.03 Da Isoelectric Point: 10.3769
>T255063 WP_012669379.1 NZ_CP103450:2074591-2074875 [Erwinia pyrifoliae]
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|