Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-RelB
Location 2066893..2067409 Replicon chromosome
Accession NZ_CP103450
Organism Erwinia pyrifoliae strain CP201179

Toxin (Protein)


Gene name relE Uniprot ID D2T7S6
Locus tag NYP81_RS09930 Protein ID WP_012669379.1
Coordinates 2067125..2067409 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D2T7S5
Locus tag NYP81_RS09925 Protein ID WP_012669378.1
Coordinates 2066893..2067135 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYP81_RS09910 (NYP81_09910) 2062222..2062590 - 369 WP_259818773.1 helix-turn-helix transcriptional regulator -
NYP81_RS09915 (NYP81_09915) 2062691..2065378 + 2688 WP_259818774.1 CHC2 zinc finger domain-containing protein -
NYP81_RS09920 (NYP81_09920) 2065577..2066632 + 1056 WP_259818775.1 site-specific tyrosine recombinase XerC -
NYP81_RS09925 (NYP81_09925) 2066893..2067135 + 243 WP_012669378.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
NYP81_RS09930 (NYP81_09930) 2067125..2067409 + 285 WP_012669379.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NYP81_RS09935 (NYP81_09935) 2067774..2068034 + 261 WP_259818776.1 hypothetical protein -
NYP81_RS09940 (NYP81_09940) 2068037..2068252 + 216 WP_259818778.1 hypothetical protein -
NYP81_RS09945 (NYP81_09945) 2068284..2068775 + 492 WP_259818780.1 hypothetical protein -
NYP81_RS09950 (NYP81_09950) 2068768..2069247 + 480 WP_259818771.1 hypothetical protein -
NYP81_RS09955 (NYP81_09955) 2069306..2069608 - 303 WP_259818772.1 type I toxin-antitoxin system SymE family toxin -
NYP81_RS09960 (NYP81_09960) 2069688..2070056 - 369 WP_259818773.1 helix-turn-helix transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2062222..2093004 30782


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-82)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(1-64)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 11123.03 Da        Isoelectric Point: 10.3769

>T255062 WP_012669379.1 NZ_CP103450:2067125-2067409 [Erwinia pyrifoliae]
MSYELVFDPRALKEWKKLGATVREQFKKKLAEVLVNPRVESARLREYPDCYKIKLKSSGYRLVYQVQDEQLVVFVVATGK
RERLQVYRDAGKRL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9070.45 Da        Isoelectric Point: 4.6310

>AT255062 WP_012669378.1 NZ_CP103450:2066893-2067135 [Erwinia pyrifoliae]
MATLNVRLDDKLKSKAYAVLDELDVSPTEAVRLLFQYIAENERLPLKTLTVSDEEDALLKTVRERLASPQKGIRVTLDEL

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB D2T7S6

Antitoxin

Source ID Structure
AlphaFold DB D2T7S5

References