Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 390295..390923 | Replicon | chromosome |
| Accession | NZ_CP103450 | ||
| Organism | Erwinia pyrifoliae strain CP201179 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | D2T444 |
| Locus tag | NYP81_RS01840 | Protein ID | WP_004156337.1 |
| Coordinates | 390295..390513 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | NYP81_RS01845 | Protein ID | WP_012668861.1 |
| Coordinates | 390543..390923 (-) | Length | 127 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP81_RS01810 (NYP81_01810) | 386278..386616 | + | 339 | WP_012668866.1 | P-II family nitrogen regulator | - |
| NYP81_RS01815 (NYP81_01815) | 386639..387940 | + | 1302 | WP_259817862.1 | ammonium transporter AmtB | - |
| NYP81_RS01820 (NYP81_01820) | 388015..388875 | - | 861 | WP_259817863.1 | acyl-CoA thioesterase II | - |
| NYP81_RS01825 (NYP81_01825) | 389099..389656 | + | 558 | WP_012668863.1 | YbaY family lipoprotein | - |
| NYP81_RS01830 (NYP81_01830) | 389679..389996 | - | 318 | WP_012668862.1 | MGMT family protein | - |
| NYP81_RS01840 (NYP81_01840) | 390295..390513 | - | 219 | WP_004156337.1 | HHA domain-containing protein | Toxin |
| NYP81_RS01845 (NYP81_01845) | 390543..390923 | - | 381 | WP_012668861.1 | Hha toxicity modulator TomB | Antitoxin |
| NYP81_RS01850 (NYP81_01850) | 391070..391423 | - | 354 | WP_012668860.1 | hypothetical protein | - |
| NYP81_RS01855 (NYP81_01855) | 391880..392026 | - | 147 | WP_259818164.1 | type B 50S ribosomal protein L36 | - |
| NYP81_RS01860 (NYP81_01860) | 392037..392297 | - | 261 | WP_012668858.1 | type B 50S ribosomal protein L31 | - |
| NYP81_RS01865 (NYP81_01865) | 392451..395591 | - | 3141 | WP_012668857.1 | multidrug efflux RND transporter permease subunit AcrB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8627.06 Da Isoelectric Point: 8.9007
>T255059 WP_004156337.1 NZ_CP103450:c390513-390295 [Erwinia pyrifoliae]
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
MTDKLLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 127 a.a. Molecular weight: 14721.47 Da Isoelectric Point: 4.8834
>AT255059 WP_012668861.1 NZ_CP103450:c390923-390543 [Erwinia pyrifoliae]
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDCDLISQIDEYL
DDTFMLFSNYGVNTHDLQRWQKSAKRLFNIFAKECLMSQVQSSHSF
MDEYSPKRHDIAQLKFLCENLYDESLATLGDSHHGWVNDPTSTSNLQLNDLIEHIAAFTMNYKIKHIEDCDLISQIDEYL
DDTFMLFSNYGVNTHDLQRWQKSAKRLFNIFAKECLMSQVQSSHSF
Download Length: 381 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|