Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 31912..32572 | Replicon | chromosome |
Accession | NZ_CP103450 | ||
Organism | Erwinia pyrifoliae strain CP201179 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | D2T6A5 |
Locus tag | NYP81_RS00175 | Protein ID | WP_014539414.1 |
Coordinates | 32159..32572 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | NYP81_RS00170 | Protein ID | WP_012669171.1 |
Coordinates | 31912..32178 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYP81_RS00150 (NYP81_00150) | 28997..29125 | + | 129 | Protein_28 | SDR family oxidoreductase | - |
NYP81_RS00155 (NYP81_00155) | 29219..29827 | - | 609 | WP_012669174.1 | HD domain-containing protein | - |
NYP81_RS00160 (NYP81_00160) | 30040..30699 | + | 660 | WP_012669173.1 | hemolysin III family protein | - |
NYP81_RS00165 (NYP81_00165) | 30700..31686 | - | 987 | WP_012669172.1 | tRNA-modifying protein YgfZ | - |
NYP81_RS00170 (NYP81_00170) | 31912..32178 | + | 267 | WP_012669171.1 | FAD assembly factor SdhE | Antitoxin |
NYP81_RS00175 (NYP81_00175) | 32159..32572 | + | 414 | WP_014539414.1 | protein YgfX | Toxin |
NYP81_RS00180 (NYP81_00180) | 32696..33214 | - | 519 | WP_012669169.1 | flavodoxin FldB | - |
NYP81_RS00185 (NYP81_00185) | 33260..34213 | - | 954 | WP_259819257.1 | DMT family transporter | - |
NYP81_RS00190 (NYP81_00190) | 34490..35383 | + | 894 | WP_014543356.1 | site-specific tyrosine recombinase XerD | - |
NYP81_RS00195 (NYP81_00195) | 35429..36133 | + | 705 | WP_259819258.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16057.13 Da Isoelectric Point: 12.3470
>T255057 WP_014539414.1 NZ_CP103450:32159-32572 [Erwinia pyrifoliae]
VVLWQCELRQSKLAQRLSLLLHGAVMLALLLPAWPASAGLVRMLLLVLVLLECIRSRRRIRRRQGDVALLGGHALRWRQR
EWRILSRPWLTRQAILLSLRDAKGERERLWLFADGMADSHWRRLRMQLLNNKEQGNG
VVLWQCELRQSKLAQRLSLLLHGAVMLALLLPAWPASAGLVRMLLLVLVLLECIRSRRRIRRRQGDVALLGGHALRWRQR
EWRILSRPWLTRQAILLSLRDAKGERERLWLFADGMADSHWRRLRMQLLNNKEQGNG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|