Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 603980..604640 | Replicon | chromosome |
| Accession | NZ_CP103445 | ||
| Organism | Erwinia pyrifoliae strain CP201486 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | D2T6A5 |
| Locus tag | NYP84_RS02810 | Protein ID | WP_014539414.1 |
| Coordinates | 604227..604640 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NYP84_RS02805 | Protein ID | WP_012669171.1 |
| Coordinates | 603980..604246 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYP84_RS02785 (NYP84_02785) | 600985..601194 | + | 210 | WP_259816865.1 | SDR family oxidoreductase | - |
| NYP84_RS02790 (NYP84_02790) | 601288..601896 | - | 609 | WP_012669174.1 | HD domain-containing protein | - |
| NYP84_RS02795 (NYP84_02795) | 602108..602767 | + | 660 | WP_012669173.1 | hemolysin III family protein | - |
| NYP84_RS02800 (NYP84_02800) | 602768..603754 | - | 987 | WP_259826094.1 | tRNA-modifying protein YgfZ | - |
| NYP84_RS02805 (NYP84_02805) | 603980..604246 | + | 267 | WP_012669171.1 | FAD assembly factor SdhE | Antitoxin |
| NYP84_RS02810 (NYP84_02810) | 604227..604640 | + | 414 | WP_014539414.1 | protein YgfX | Toxin |
| NYP84_RS02815 (NYP84_02815) | 604764..605282 | - | 519 | WP_012669169.1 | flavodoxin FldB | - |
| NYP84_RS02820 (NYP84_02820) | 605328..606281 | - | 954 | WP_259826095.1 | DMT family transporter | - |
| NYP84_RS02825 (NYP84_02825) | 606607..607500 | + | 894 | WP_014543356.1 | site-specific tyrosine recombinase XerD | - |
| NYP84_RS02830 (NYP84_02830) | 607546..608250 | + | 705 | WP_012669166.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16057.13 Da Isoelectric Point: 12.3470
>T255047 WP_014539414.1 NZ_CP103445:604227-604640 [Erwinia pyrifoliae]
VVLWQCELRQSKLAQRLSLLLHGAVMLALLLPAWPASAGLVRMLLLVLVLLECIRSRRRIRRRQGDVALLGGHALRWRQR
EWRILSRPWLTRQAILLSLRDAKGERERLWLFADGMADSHWRRLRMQLLNNKEQGNG
VVLWQCELRQSKLAQRLSLLLHGAVMLALLLPAWPASAGLVRMLLLVLVLLECIRSRRRIRRRQGDVALLGGHALRWRQR
EWRILSRPWLTRQAILLSLRDAKGERERLWLFADGMADSHWRRLRMQLLNNKEQGNG
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|