Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 31530..32055 | Replicon | plasmid unnamed2 |
Accession | NZ_CP103422 | ||
Organism | Klebsiella variicola strain KV1 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | NYO12_RS29910 | Protein ID | WP_259075173.1 |
Coordinates | 31530..31835 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | NYO12_RS29915 | Protein ID | WP_259075175.1 |
Coordinates | 31837..32055 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYO12_RS29885 (NYO12_29885) | 27855..28610 | - | 756 | WP_063445611.1 | replication initiation protein RepE | - |
NYO12_RS29890 (NYO12_29890) | 29135..29314 | + | 180 | WP_259075166.1 | hypothetical protein | - |
NYO12_RS29895 (NYO12_29895) | 29462..30157 | - | 696 | WP_259075183.1 | IS6 family transposase | - |
NYO12_RS29900 (NYO12_29900) | 30490..31281 | - | 792 | WP_259075168.1 | site-specific integrase | - |
NYO12_RS29905 (NYO12_29905) | 31278..31409 | - | 132 | WP_259075171.1 | hypothetical protein | - |
NYO12_RS29910 (NYO12_29910) | 31530..31835 | - | 306 | WP_259075173.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
NYO12_RS29915 (NYO12_29915) | 31837..32055 | - | 219 | WP_259075175.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
NYO12_RS29920 (NYO12_29920) | 32645..33649 | + | 1005 | WP_259075177.1 | hypothetical protein | - |
NYO12_RS29925 (NYO12_29925) | 33929..34012 | + | 84 | Protein_33 | IS6 family transposase | - |
NYO12_RS29930 (NYO12_29930) | 34532..35524 | + | 993 | WP_168429828.1 | hypothetical protein | - |
NYO12_RS29935 (NYO12_29935) | 35581..35712 | + | 132 | Protein_35 | ISNCY family transposase | - |
NYO12_RS29940 (NYO12_29940) | 35709..36320 | - | 612 | WP_259075180.1 | DUF2913 family protein | - |
NYO12_RS29945 (NYO12_29945) | 36374..36655 | - | 282 | WP_259075181.1 | cytoplasmic protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..81805 | 81805 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11660.48 Da Isoelectric Point: 5.1068
>T255046 WP_259075173.1 NZ_CP103422:c31835-31530 [Klebsiella variicola]
MQFRVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLTCARLLSDKVSRELYPVVQIGDDSYRLMTTDMASVPAPVIGEEV
ADLSVRENDIKNAINLMFWGI
MQFRVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLTCARLLSDKVSRELYPVVQIGDDSYRLMTTDMASVPAPVIGEEV
ADLSVRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|