Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataRT/DUF1778(antitoxin) |
| Location | 166417..167168 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP103421 | ||
| Organism | Klebsiella variicola strain KV1 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A486R6L7 |
| Locus tag | NYO12_RS28705 | Protein ID | WP_041165502.1 |
| Coordinates | 166417..166899 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | ataR | Uniprot ID | A0A6S4YWG5 |
| Locus tag | NYO12_RS28710 | Protein ID | WP_012540170.1 |
| Coordinates | 166890..167168 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO12_RS28680 (NYO12_28680) | 162457..163185 | - | 729 | WP_251895943.1 | hypothetical protein | - |
| NYO12_RS28685 (NYO12_28685) | 164230..164466 | + | 237 | WP_012540047.1 | hypothetical protein | - |
| NYO12_RS28690 (NYO12_28690) | 164561..164710 | - | 150 | WP_223884741.1 | bacteriocin immunity protein | - |
| NYO12_RS28695 (NYO12_28695) | 164822..165655 | - | 834 | WP_012540133.1 | GIY-YIG nuclease family protein | - |
| NYO12_RS28700 (NYO12_28700) | 165975..166379 | - | 405 | WP_048293664.1 | DUF2251 domain-containing protein | - |
| NYO12_RS28705 (NYO12_28705) | 166417..166899 | - | 483 | WP_041165502.1 | GNAT family N-acetyltransferase | Toxin |
| NYO12_RS28710 (NYO12_28710) | 166890..167168 | - | 279 | WP_012540170.1 | DUF1778 domain-containing protein | Antitoxin |
| NYO12_RS28715 (NYO12_28715) | 167476..168012 | + | 537 | WP_048293663.1 | hypothetical protein | - |
| NYO12_RS28720 (NYO12_28720) | 169017..169331 | + | 315 | WP_058837182.1 | hypothetical protein | - |
| NYO12_RS28725 (NYO12_28725) | 169575..170057 | - | 483 | WP_004210306.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..378475 | 378475 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17697.61 Da Isoelectric Point: 9.4948
>T255043 WP_041165502.1 NZ_CP103421:c166899-166417 [Klebsiella variicola]
MGMRPPEPLTPEHNIADFCCQDQVLSEWLKKKALKNHSTGLSRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTQHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
MGMRPPEPLTPEHNIADFCCQDQVLSEWLKKKALKNHSTGLSRVFVVCAENTNRVIAYYCLASGSVHRNTVPGAYRRNAP
EALPVIVLGRLAVDAAWARKGLGAALLKDAIYRTQHIAIQVGVRALLVHALNDEVREFYTKFGFEPSIANALTLLFPIKT
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A486R6L7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6S4YWG5 |