Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 123934..124670 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP103421 | ||
| Organism | Klebsiella variicola strain KV1 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | - |
| Locus tag | NYO12_RS28485 | Protein ID | WP_259075028.1 |
| Coordinates | 124188..124670 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | - |
| Locus tag | NYO12_RS28480 | Protein ID | WP_049083184.1 |
| Coordinates | 123934..124200 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO12_RS28455 (NYO12_28455) | 119533..120411 | - | 879 | WP_080895811.1 | hypothetical protein | - |
| NYO12_RS28460 (NYO12_28460) | 120408..120857 | - | 450 | WP_072046253.1 | NUDIX domain-containing protein | - |
| NYO12_RS28465 (NYO12_28465) | 120854..122026 | - | 1173 | WP_110191897.1 | DegT/DnrJ/EryC1/StrS family aminotransferase | - |
| NYO12_RS28470 (NYO12_28470) | 122274..123023 | - | 750 | WP_080783468.1 | SDR family oxidoreductase | - |
| NYO12_RS28475 (NYO12_28475) | 123481..123693 | + | 213 | WP_226908518.1 | cell envelope integrity protein TolA | - |
| NYO12_RS28480 (NYO12_28480) | 123934..124200 | + | 267 | WP_049083184.1 | DUF1778 domain-containing protein | Antitoxin |
| NYO12_RS28485 (NYO12_28485) | 124188..124670 | + | 483 | WP_259075028.1 | GNAT family N-acetyltransferase | Toxin |
| NYO12_RS28490 (NYO12_28490) | 124848..126251 | + | 1404 | WP_259075030.1 | ISNCY family transposase | - |
| NYO12_RS28495 (NYO12_28495) | 126284..126907 | - | 624 | Protein_154 | arsenical resistance protein ArsH | - |
| NYO12_RS28500 (NYO12_28500) | 127074..127394 | + | 321 | WP_000941305.1 | transcriptional regulator | - |
| NYO12_RS28505 (NYO12_28505) | 127440..128729 | + | 1290 | WP_000922628.1 | arsenic transporter | - |
| NYO12_RS28510 (NYO12_28510) | 128742..129167 | + | 426 | WP_000065802.1 | glutaredoxin-dependent arsenate reductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..378475 | 378475 | |
| - | flank | IS/Tn | - | - | 118733..119428 | 695 | |
| - | flank | IS/Tn | - | - | 124848..126251 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17240.87 Da Isoelectric Point: 8.7400
>T255042 WP_259075028.1 NZ_CP103421:124188-124670 [Klebsiella variicola]
VGCITAPEPLSSAHQLADFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGCITAPEPLSSAHQLADFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|