Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 20272..20849 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP103421 | ||
| Organism | Klebsiella variicola strain KV1 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | NYO12_RS27845 | Protein ID | WP_142983937.1 |
| Coordinates | 20517..20849 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | - |
| Locus tag | NYO12_RS27840 | Protein ID | WP_142983938.1 |
| Coordinates | 20272..20517 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO12_RS27810 (NYO12_27810) | 15835..16680 | + | 846 | WP_172092758.1 | TAXI family TRAP transporter solute-binding subunit | - |
| NYO12_RS27815 (NYO12_27815) | 16683..16832 | + | 150 | WP_177344245.1 | hypothetical protein | - |
| NYO12_RS27820 (NYO12_27820) | 17480..17683 | - | 204 | WP_141651176.1 | hypothetical protein | - |
| NYO12_RS27825 (NYO12_27825) | 17853..18245 | - | 393 | WP_259075084.1 | transposase | - |
| NYO12_RS27830 (NYO12_27830) | 18265..19233 | + | 969 | WP_072210033.1 | IS5-like element IS903B family transposase | - |
| NYO12_RS27835 (NYO12_27835) | 19486..20097 | - | 612 | WP_259074898.1 | hypothetical protein | - |
| NYO12_RS27840 (NYO12_27840) | 20272..20517 | + | 246 | WP_142983938.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NYO12_RS27845 (NYO12_27845) | 20517..20849 | + | 333 | WP_142983937.1 | endoribonuclease MazF | Toxin |
| NYO12_RS27850 (NYO12_27850) | 20986..21171 | + | 186 | WP_259074904.1 | hypothetical protein | - |
| NYO12_RS27855 (NYO12_27855) | 21259..21615 | - | 357 | WP_259074905.1 | hypothetical protein | - |
| NYO12_RS27860 (NYO12_27860) | 22149..22412 | + | 264 | WP_074427173.1 | hypothetical protein | - |
| NYO12_RS27865 (NYO12_27865) | 22503..22808 | + | 306 | WP_259074908.1 | hypothetical protein | - |
| NYO12_RS27870 (NYO12_27870) | 22859..23353 | - | 495 | WP_259074911.1 | hypothetical protein | - |
| NYO12_RS27875 (NYO12_27875) | 23479..24183 | + | 705 | WP_072045578.1 | IS6 family transposase | - |
| NYO12_RS27880 (NYO12_27880) | 24396..24533 | - | 138 | WP_162823005.1 | hypothetical protein | - |
| NYO12_RS27885 (NYO12_27885) | 24537..24713 | - | 177 | WP_172092776.1 | hypothetical protein | - |
| NYO12_RS27890 (NYO12_27890) | 24801..25118 | + | 318 | WP_259074921.1 | host cell division inhibitor Icd-like protein | - |
| NYO12_RS27895 (NYO12_27895) | 25364..25585 | + | 222 | WP_072045579.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..378475 | 378475 | |
| - | inside | IScluster/Tn | - | - | 17853..40421 | 22568 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11927.78 Da Isoelectric Point: 8.2685
>T255041 WP_142983937.1 NZ_CP103421:20517-20849 [Klebsiella variicola]
MVKRYVPDAGDLIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTQIKGYPFEVTLSGSKEGVALSDQVTCV
DWRARKVSKKDAVNSTELAEIRAKAKALIG
MVKRYVPDAGDLIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTQIKGYPFEVTLSGSKEGVALSDQVTCV
DWRARKVSKKDAVNSTELAEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|