Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907-MazE
Location 20272..20849 Replicon plasmid unnamed1
Accession NZ_CP103421
Organism Klebsiella variicola strain KV1

Toxin (Protein)


Gene name mazF Uniprot ID -
Locus tag NYO12_RS27845 Protein ID WP_142983937.1
Coordinates 20517..20849 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID -
Locus tag NYO12_RS27840 Protein ID WP_142983938.1
Coordinates 20272..20517 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO12_RS27810 (NYO12_27810) 15835..16680 + 846 WP_172092758.1 TAXI family TRAP transporter solute-binding subunit -
NYO12_RS27815 (NYO12_27815) 16683..16832 + 150 WP_177344245.1 hypothetical protein -
NYO12_RS27820 (NYO12_27820) 17480..17683 - 204 WP_141651176.1 hypothetical protein -
NYO12_RS27825 (NYO12_27825) 17853..18245 - 393 WP_259075084.1 transposase -
NYO12_RS27830 (NYO12_27830) 18265..19233 + 969 WP_072210033.1 IS5-like element IS903B family transposase -
NYO12_RS27835 (NYO12_27835) 19486..20097 - 612 WP_259074898.1 hypothetical protein -
NYO12_RS27840 (NYO12_27840) 20272..20517 + 246 WP_142983938.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NYO12_RS27845 (NYO12_27845) 20517..20849 + 333 WP_142983937.1 endoribonuclease MazF Toxin
NYO12_RS27850 (NYO12_27850) 20986..21171 + 186 WP_259074904.1 hypothetical protein -
NYO12_RS27855 (NYO12_27855) 21259..21615 - 357 WP_259074905.1 hypothetical protein -
NYO12_RS27860 (NYO12_27860) 22149..22412 + 264 WP_074427173.1 hypothetical protein -
NYO12_RS27865 (NYO12_27865) 22503..22808 + 306 WP_259074908.1 hypothetical protein -
NYO12_RS27870 (NYO12_27870) 22859..23353 - 495 WP_259074911.1 hypothetical protein -
NYO12_RS27875 (NYO12_27875) 23479..24183 + 705 WP_072045578.1 IS6 family transposase -
NYO12_RS27880 (NYO12_27880) 24396..24533 - 138 WP_162823005.1 hypothetical protein -
NYO12_RS27885 (NYO12_27885) 24537..24713 - 177 WP_172092776.1 hypothetical protein -
NYO12_RS27890 (NYO12_27890) 24801..25118 + 318 WP_259074921.1 host cell division inhibitor Icd-like protein -
NYO12_RS27895 (NYO12_27895) 25364..25585 + 222 WP_072045579.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..378475 378475
- inside IScluster/Tn - - 17853..40421 22568


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(9-107)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 11927.78 Da        Isoelectric Point: 8.2685

>T255041 WP_142983937.1 NZ_CP103421:20517-20849 [Klebsiella variicola]
MVKRYVPDAGDLIWIDFDPVAGHEQGGHRPAVVLSPFAYNNKVGLLLCVPCTTQIKGYPFEVTLSGSKEGVALSDQVTCV
DWRARKVSKKDAVNSTELAEIRAKAKALIG

Download         Length: 333 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 8686.00 Da        Isoelectric Point: 4.7045

>AT255041 WP_142983938.1 NZ_CP103421:20272-20517 [Klebsiella variicola]
MAQAIVKKWGNSPSVRLPVAVMKAASLNVDDTVDIEVEDGRIIIVPVRQKEYSLDALLAGISTDNLHGKADFGPAEGKEL
L

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References