Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5534660..5535285 | Replicon | chromosome |
Accession | NZ_CP103420 | ||
Organism | Klebsiella variicola strain KV1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A1F2M041 |
Locus tag | NYO12_RS27360 | Protein ID | WP_008807903.1 |
Coordinates | 5534660..5535043 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | NYO12_RS27365 | Protein ID | WP_004150355.1 |
Coordinates | 5535043..5535285 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYO12_RS27345 (5532026) | 5532026..5532928 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
NYO12_RS27350 (5532925) | 5532925..5533560 | + | 636 | WP_008807902.1 | formate dehydrogenase cytochrome b556 subunit | - |
NYO12_RS27355 (5533557) | 5533557..5534486 | + | 930 | WP_004150358.1 | formate dehydrogenase accessory protein FdhE | - |
NYO12_RS27360 (5534660) | 5534660..5535043 | - | 384 | WP_008807903.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NYO12_RS27365 (5535043) | 5535043..5535285 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
NYO12_RS27370 (5535490) | 5535490..5536407 | + | 918 | WP_259072597.1 | alpha/beta hydrolase | - |
NYO12_RS27375 (5536422) | 5536422..5537363 | - | 942 | WP_012543287.1 | fatty acid biosynthesis protein FabY | - |
NYO12_RS27380 (5537408) | 5537408..5537845 | - | 438 | WP_012543288.1 | D-aminoacyl-tRNA deacylase | - |
NYO12_RS27385 (5537842) | 5537842..5538702 | - | 861 | WP_008807907.1 | virulence factor BrkB family protein | - |
NYO12_RS27390 (5538696) | 5538696..5539295 | - | 600 | WP_008807908.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T255040 WP_008807903.1 NZ_CP103420:c5535043-5534660 [Klebsiella variicola]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYELHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1F2M041 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |