Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4948189..4948765 | Replicon | chromosome |
| Accession | NZ_CP103420 | ||
| Organism | Klebsiella variicola strain KV1 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | NYO12_RS24620 | Protein ID | WP_012542979.1 |
| Coordinates | 4948478..4948765 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | - |
| Locus tag | NYO12_RS24615 | Protein ID | WP_022065028.1 |
| Coordinates | 4948189..4948491 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO12_RS24590 (4943605) | 4943605..4944669 | - | 1065 | WP_042947982.1 | DUF2955 domain-containing protein | - |
| NYO12_RS24595 (4944659) | 4944659..4945726 | - | 1068 | WP_039102796.1 | HlyD family secretion protein | - |
| NYO12_RS24600 (4945733) | 4945733..4946197 | - | 465 | WP_012969020.1 | MarR family transcriptional regulator | - |
| NYO12_RS24605 (4946363) | 4946363..4946527 | - | 165 | WP_008807599.1 | DUF1127 domain-containing protein | - |
| NYO12_RS24610 (4946705) | 4946705..4948117 | + | 1413 | WP_008807600.1 | PLP-dependent aminotransferase family protein | - |
| NYO12_RS24615 (4948189) | 4948189..4948491 | - | 303 | WP_022065028.1 | BrnA antitoxin family protein | Antitoxin |
| NYO12_RS24620 (4948478) | 4948478..4948765 | - | 288 | WP_012542979.1 | BrnT family toxin | Toxin |
| NYO12_RS24625 (4948933) | 4948933..4949356 | - | 424 | Protein_4837 | FosA5 family fosfomycin resistance glutathione transferase | - |
| NYO12_RS24630 (4949350) | 4949350..4950258 | - | 909 | WP_023339531.1 | LysR family transcriptional regulator | - |
| NYO12_RS24635 (4950345) | 4950345..4951127 | + | 783 | WP_016160218.1 | NAD(P)H-dependent oxidoreductase | - |
| NYO12_RS24640 (4951165) | 4951165..4952121 | - | 957 | WP_016160217.1 | ABC transporter permease | - |
| NYO12_RS24645 (4952118) | 4952118..4953089 | - | 972 | WP_008807605.1 | ABC transporter permease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11245.77 Da Isoelectric Point: 8.6574
>T255038 WP_012542979.1 NZ_CP103420:c4948765-4948478 [Klebsiella variicola]
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG
MPMEFEWDANKALSNLRKHGVRFEEAVLVFDDPRHLSRQERFENGEYRWQTIGLVHGILVILVAHSVRFESGTEVIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|