Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4340942..4341561 Replicon chromosome
Accession NZ_CP103420
Organism Klebsiella variicola strain KV1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NYO12_RS21675 Protein ID WP_002892050.1
Coordinates 4341343..4341561 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag NYO12_RS21670 Protein ID WP_008805436.1
Coordinates 4340942..4341316 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO12_RS21660 (4336097) 4336097..4337290 + 1194 WP_012542667.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NYO12_RS21665 (4337313) 4337313..4340459 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
NYO12_RS21670 (4340942) 4340942..4341316 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
NYO12_RS21675 (4341343) 4341343..4341561 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NYO12_RS21680 (4341720) 4341720..4342286 + 567 WP_008805435.1 maltose O-acetyltransferase -
NYO12_RS21685 (4342258) 4342258..4342386 - 129 Protein_4261 hypothetical protein -
NYO12_RS21690 (4342423) 4342423..4342893 + 471 WP_008805434.1 YlaC family protein -
NYO12_RS21695 (4342862) 4342862..4344319 - 1458 WP_016160392.1 PLP-dependent aminotransferase family protein -
NYO12_RS21700 (4344420) 4344420..4345118 + 699 WP_023297138.1 GNAT family protein -
NYO12_RS21705 (4345115) 4345115..4345255 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NYO12_RS21710 (4345255) 4345255..4345518 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255037 WP_002892050.1 NZ_CP103420:4341343-4341561 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT255037 WP_008805436.1 NZ_CP103420:4340942-4341316 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References