Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1872192..1872782 | Replicon | chromosome |
| Accession | NZ_CP103420 | ||
| Organism | Klebsiella variicola strain KV1 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | NYO12_RS09235 | Protein ID | WP_023322934.1 |
| Coordinates | 1872450..1872782 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1F2LZQ3 |
| Locus tag | NYO12_RS09230 | Protein ID | WP_012541132.1 |
| Coordinates | 1872192..1872449 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO12_RS09210 (1867802) | 1867802..1868377 | + | 576 | WP_023322936.1 | hypothetical protein | - |
| NYO12_RS09215 (1868554) | 1868554..1869390 | + | 837 | WP_008804155.1 | alpha/beta hydrolase | - |
| NYO12_RS09220 (1869597) | 1869597..1870568 | + | 972 | WP_016161433.1 | sensor domain-containing diguanylate cyclase | - |
| NYO12_RS09225 (1870565) | 1870565..1871665 | - | 1101 | WP_087653750.1 | AarF/UbiB family protein | - |
| NYO12_RS09230 (1872192) | 1872192..1872449 | + | 258 | WP_012541132.1 | antitoxin | Antitoxin |
| NYO12_RS09235 (1872450) | 1872450..1872782 | + | 333 | WP_023322934.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| NYO12_RS09245 (1873105) | 1873105..1874541 | + | 1437 | WP_016161429.1 | EmmdR/YeeO family multidrug/toxin efflux MATE transporter | - |
| NYO12_RS09255 (1874914) | 1874914..1876368 | - | 1455 | WP_259073653.1 | AMP nucleosidase | - |
| NYO12_RS09260 (1876499) | 1876499..1876744 | - | 246 | WP_008804171.1 | signal transduction protein PmrD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11768.58 Da Isoelectric Point: 9.2926
>T255031 WP_023322934.1 NZ_CP103420:1872450-1872782 [Klebsiella variicola]
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPGTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
MDRGEIWLVSLDPIAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEEAGTKTTGVIRCDQPGTI
DMAARNGKRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|