Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 320874..321460 Replicon chromosome
Accession NZ_CP103420
Organism Klebsiella variicola strain KV1

Toxin (Protein)


Gene name doc Uniprot ID A0A2W7TCK5
Locus tag NYO12_RS01475 Protein ID WP_008806973.1
Coordinates 321092..321460 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A1F2M0C2
Locus tag NYO12_RS01470 Protein ID WP_032731361.1
Coordinates 320874..321095 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO12_RS01450 (317031) 317031..317957 + 927 WP_012540389.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NYO12_RS01455 (317954) 317954..319231 + 1278 WP_008806971.1 branched chain amino acid ABC transporter permease LivM -
NYO12_RS01460 (319228) 319228..319995 + 768 WP_032731362.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NYO12_RS01465 (319997) 319997..320710 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NYO12_RS01470 (320874) 320874..321095 + 222 WP_032731361.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NYO12_RS01475 (321092) 321092..321460 + 369 WP_008806973.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NYO12_RS01480 (321737) 321737..323053 + 1317 WP_022066271.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NYO12_RS01485 (323160) 323160..324047 + 888 WP_012967120.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NYO12_RS01490 (324044) 324044..324889 + 846 WP_044643074.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NYO12_RS01495 (324891) 324891..325961 + 1071 WP_008806977.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 317954..326698 8744


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(6-116)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13639.01 Da        Isoelectric Point: 7.3191

>T255028 WP_008806973.1 NZ_CP103420:321092-321460 [Klebsiella variicola]
MTLQIISAEEIIQFHDRLLRVTPDVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLVISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8165.18 Da        Isoelectric Point: 4.7769

>AT255028 WP_032731361.1 NZ_CP103420:320874-321095 [Klebsiella variicola]
MRTVNYSEARQNLADVLESAVTGIPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2W7TCK5

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2M0C2

References