Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4225887..4226506 Replicon chromosome
Accession NZ_CP103419
Organism Klebsiella variicola strain KV4

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NYO13_RS20435 Protein ID WP_002892050.1
Coordinates 4226288..4226506 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID A0A1F2MBN7
Locus tag NYO13_RS20430 Protein ID WP_008805436.1
Coordinates 4225887..4226261 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NYO13_RS20420 (NYO13_20420) 4221042..4222235 + 1194 WP_008805438.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NYO13_RS20425 (NYO13_20425) 4222258..4225404 + 3147 WP_008805437.1 multidrug efflux RND transporter permease subunit AcrB -
NYO13_RS20430 (NYO13_20430) 4225887..4226261 + 375 WP_008805436.1 Hha toxicity modulator TomB Antitoxin
NYO13_RS20435 (NYO13_20435) 4226288..4226506 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NYO13_RS20440 (NYO13_20440) 4226665..4227231 + 567 WP_008805435.1 maltose O-acetyltransferase -
NYO13_RS20445 (NYO13_20445) 4227203..4227331 - 129 Protein_4015 hypothetical protein -
NYO13_RS20450 (NYO13_20450) 4227368..4227838 + 471 WP_008805434.1 YlaC family protein -
NYO13_RS20455 (NYO13_20455) 4227807..4229264 - 1458 WP_008805433.1 PLP-dependent aminotransferase family protein -
NYO13_RS20460 (NYO13_20460) 4229365..4230063 + 699 WP_016160391.1 GNAT family protein -
NYO13_RS20465 (NYO13_20465) 4230060..4230200 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NYO13_RS20470 (NYO13_20470) 4230200..4230463 - 264 WP_008805431.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T255025 WP_002892050.1 NZ_CP103419:4226288-4226506 [Klebsiella variicola]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14384.06 Da        Isoelectric Point: 4.8989

>AT255025 WP_008805436.1 NZ_CP103419:4225887-4226261 [Klebsiella variicola]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYTEDNKLVAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A1F2MBN7

References