Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 795239..795896 | Replicon | chromosome |
| Accession | NZ_CP103419 | ||
| Organism | Klebsiella variicola strain KV4 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | W8UCT0 |
| Locus tag | NYO13_RS03905 | Protein ID | WP_002916310.1 |
| Coordinates | 795486..795896 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W8UQ37 |
| Locus tag | NYO13_RS03900 | Protein ID | WP_002916312.1 |
| Coordinates | 795239..795505 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYO13_RS03875 (NYO13_03875) | 790284..791717 | - | 1434 | WP_008806432.1 | 6-phospho-beta-glucosidase BglA | - |
| NYO13_RS03880 (NYO13_03880) | 791837..792565 | - | 729 | WP_032701093.1 | MurR/RpiR family transcriptional regulator | - |
| NYO13_RS03885 (NYO13_03885) | 792616..792927 | + | 312 | WP_048330660.1 | N(4)-acetylcytidine aminohydrolase | - |
| NYO13_RS03890 (NYO13_03890) | 793091..793750 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| NYO13_RS03895 (NYO13_03895) | 794010..794993 | - | 984 | WP_008806428.1 | tRNA-modifying protein YgfZ | - |
| NYO13_RS03900 (NYO13_03900) | 795239..795505 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
| NYO13_RS03905 (NYO13_03905) | 795486..795896 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
| NYO13_RS03910 (NYO13_03910) | 795903..796424 | - | 522 | WP_008806427.1 | flavodoxin FldB | - |
| NYO13_RS03915 (NYO13_03915) | 796525..797421 | + | 897 | WP_259144995.1 | site-specific tyrosine recombinase XerD | - |
| NYO13_RS03920 (NYO13_03920) | 797444..798157 | + | 714 | WP_008806425.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NYO13_RS03925 (NYO13_03925) | 798163..799896 | + | 1734 | WP_259144996.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T255015 WP_002916310.1 NZ_CP103419:795486-795896 [Klebsiella variicola]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GSW7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GY41 |