Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1296674..1297591 | Replicon | chromosome |
Accession | NZ_CP103412 | ||
Organism | Bacillus velezensis strain HF-14109 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NX856_RS06945 | Protein ID | WP_032866111.1 |
Coordinates | 1296845..1297591 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | I2HQ14 |
Locus tag | NX856_RS06940 | Protein ID | WP_003154807.1 |
Coordinates | 1296674..1296844 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NX856_RS06900 (1291886) | 1291886..1293475 | + | 1590 | WP_205164551.1 | hypothetical protein | - |
NX856_RS06905 (1293488) | 1293488..1293913 | + | 426 | WP_050498185.1 | hypothetical protein | - |
NX856_RS06910 (1293918) | 1293918..1294115 | + | 198 | WP_007610833.1 | XkdX family protein | - |
NX856_RS06915 (1294172) | 1294172..1294933 | + | 762 | WP_020955694.1 | hypothetical protein | - |
NX856_RS06920 (1294985) | 1294985..1295248 | + | 264 | WP_003154815.1 | hemolysin XhlA family protein | - |
NX856_RS06925 (1295262) | 1295262..1295525 | + | 264 | WP_003154813.1 | phage holin | - |
NX856_RS06930 (1295539) | 1295539..1296417 | + | 879 | WP_020955695.1 | N-acetylmuramoyl-L-alanine amidase | - |
NX856_RS06935 (1296452) | 1296452..1296577 | - | 126 | WP_023356844.1 | hypothetical protein | - |
NX856_RS06940 (1296674) | 1296674..1296844 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
NX856_RS06945 (1296845) | 1296845..1297591 | - | 747 | WP_032866111.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
NX856_RS06950 (1297695) | 1297695..1298693 | - | 999 | WP_020955696.1 | inorganic phosphate transporter | - |
NX856_RS06955 (1298706) | 1298706..1299323 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
NX856_RS06960 (1299609) | 1299609..1300925 | - | 1317 | WP_007407254.1 | amino acid permease | - |
NX856_RS06965 (1301248) | 1301248..1302198 | + | 951 | WP_218791607.1 | ring-cleaving dioxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1261670..1305848 | 44178 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29095.60 Da Isoelectric Point: 4.7755
>T255008 WP_032866111.1 NZ_CP103412:c1297591-1296845 [Bacillus velezensis]
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLMFFQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVLGSMVYWTYDPESLFAAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRHYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|