Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 485416..486053 | Replicon | chromosome |
| Accession | NZ_CP103412 | ||
| Organism | Bacillus velezensis strain HF-14109 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | NX856_RS02495 | Protein ID | WP_003156187.1 |
| Coordinates | 485703..486053 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | I2HMS5 |
| Locus tag | NX856_RS02490 | Protein ID | WP_003156188.1 |
| Coordinates | 485416..485697 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NX856_RS02470 (481781) | 481781..482380 | - | 600 | WP_003156193.1 | rhomboid family intramembrane serine protease | - |
| NX856_RS02475 (482473) | 482473..482838 | + | 366 | WP_007410229.1 | holo-ACP synthase | - |
| NX856_RS02480 (483003) | 483003..484010 | + | 1008 | WP_007410230.1 | outer membrane lipoprotein carrier protein LolA | - |
| NX856_RS02485 (484127) | 484127..485296 | + | 1170 | WP_025284272.1 | alanine racemase | - |
| NX856_RS02490 (485416) | 485416..485697 | + | 282 | WP_003156188.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| NX856_RS02495 (485703) | 485703..486053 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| NX856_RS02500 (486171) | 486171..486992 | + | 822 | WP_003156182.1 | STAS domain-containing protein | - |
| NX856_RS02505 (486997) | 486997..487362 | + | 366 | WP_003156180.1 | RsbT antagonist protein RsbS | - |
| NX856_RS02510 (487365) | 487365..487766 | + | 402 | WP_003156178.1 | anti-sigma regulatory factor | - |
| NX856_RS02515 (487778) | 487778..488785 | + | 1008 | WP_052827076.1 | PP2C family protein-serine/threonine phosphatase | - |
| NX856_RS02520 (488849) | 488849..489178 | + | 330 | WP_003156176.1 | anti-sigma factor antagonist RsbV | - |
| NX856_RS02525 (489175) | 489175..489657 | + | 483 | WP_003156173.1 | anti-sigma B factor RsbW | - |
| NX856_RS02530 (489623) | 489623..490411 | + | 789 | WP_003156171.1 | RNA polymerase sigma factor SigB | - |
| NX856_RS02535 (490411) | 490411..491013 | + | 603 | WP_007410234.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T255007 WP_003156187.1 NZ_CP103412:485703-486053 [Bacillus velezensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|