Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | /RES-TIGR02293 |
Location | 496301..497211 | Replicon | plasmid unnamed1 |
Accession | NZ_CP103402 | ||
Organism | Pantoea agglomerans strain CHTF15 |
Toxin (Protein)
Gene name | - | Uniprot ID | - |
Locus tag | NYF24_RS21135 | Protein ID | WP_033760865.1 |
Coordinates | 496741..497211 (+) | Length | 157 a.a. |
Antitoxin (Protein)
Gene name | - | Uniprot ID | A0A7X5S5X4 |
Locus tag | NYF24_RS21130 | Protein ID | WP_033760867.1 |
Coordinates | 496301..496744 (+) | Length | 148 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NYF24_RS21105 (NYF24_21105) | 492518..493423 | - | 906 | WP_258996083.1 | alpha/beta hydrolase | - |
NYF24_RS21110 (NYF24_21110) | 493474..494088 | - | 615 | WP_060678871.1 | TetR/AcrR family transcriptional regulator | - |
NYF24_RS21115 (NYF24_21115) | 494302..494719 | + | 418 | Protein_482 | LysR substrate-binding domain-containing protein | - |
NYF24_RS21120 (NYF24_21120) | 494754..495743 | - | 990 | WP_182504891.1 | aldo/keto reductase | - |
NYF24_RS21125 (NYF24_21125) | 495709..495921 | - | 213 | Protein_484 | hypothetical protein | - |
NYF24_RS21130 (NYF24_21130) | 496301..496744 | + | 444 | WP_033760867.1 | DUF2384 domain-containing protein | Antitoxin |
NYF24_RS21135 (NYF24_21135) | 496741..497211 | + | 471 | WP_033760865.1 | RES family NAD+ phosphorylase | Toxin |
NYF24_RS21140 (NYF24_21140) | 497382..498413 | + | 1032 | WP_033760863.1 | AI-2E family transporter | - |
NYF24_RS21145 (NYF24_21145) | 498402..501131 | - | 2730 | WP_124890726.1 | cation-transporting P-type ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN | 1..514938 | 514938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17480.92 Da Isoelectric Point: 4.7790
>T255004 WP_033760865.1 NZ_CP103402:496741-497211 [Pantoea agglomerans]
MILYRLTKTKYLSTAWTGFGAKEAGGRWNSIGISMVYVSETASLTLLETLVHLHSAHILDAFTLLRIDVPDALIQTADIT
ELPANWADEDAPAELADYGDAWCSACDAVALRVPSALSPVEYNYLLNPEHPEFFRIVQQAEAIPFRFDRRLKPDRK
MILYRLTKTKYLSTAWTGFGAKEAGGRWNSIGISMVYVSETASLTLLETLVHLHSAHILDAFTLLRIDVPDALIQTADIT
ELPANWADEDAPAELADYGDAWCSACDAVALRVPSALSPVEYNYLLNPEHPEFFRIVQQAEAIPFRFDRRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16489.88 Da Isoelectric Point: 9.9250
>AT255004 WP_033760867.1 NZ_CP103402:496301-496744 [Pantoea agglomerans]
MKTFSFSANKTRPPRLWQAAGLNNADGVALLGQINEGLDGNVAHLIVNWAKITQNDLRKMSGIPSTTFSRSVKAKFSAEQ
SERLVRIIRVIDRAVELFEGDKDEAQKWLNEPNRALSWKMPAELMASETGAYEVMKLITRLEHGVYS
MKTFSFSANKTRPPRLWQAAGLNNADGVALLGQINEGLDGNVAHLIVNWAKITQNDLRKMSGIPSTTFSRSVKAKFSAEQ
SERLVRIIRVIDRAVELFEGDKDEAQKWLNEPNRALSWKMPAELMASETGAYEVMKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|