Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 3303699..3304324 | Replicon | chromosome |
| Accession | NZ_CP103401 | ||
| Organism | Pantoea agglomerans strain CHTF15 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | NYF24_RS15615 | Protein ID | WP_158149559.1 |
| Coordinates | 3304145..3304324 (-) | Length | 60 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NYF24_RS15610 | Protein ID | WP_158149558.1 |
| Coordinates | 3303699..3304118 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NYF24_RS15580 (3298817) | 3298817..3299326 | - | 510 | WP_039391324.1 | phenolic acid decarboxylase | - |
| NYF24_RS15585 (3299432) | 3299432..3300331 | + | 900 | WP_158149554.1 | LysR family transcriptional regulator | - |
| NYF24_RS15590 (3300352) | 3300352..3300735 | - | 384 | WP_115764296.1 | hypothetical protein | - |
| NYF24_RS15595 (3300921) | 3300921..3302243 | + | 1323 | WP_179256891.1 | DUF4062 domain-containing protein | - |
| NYF24_RS15600 (3302357) | 3302357..3303286 | - | 930 | WP_158149556.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| NYF24_RS15605 (3303522) | 3303522..3303611 | - | 90 | Protein_3038 | CRISPR-associated protein Cas1 | - |
| NYF24_RS15610 (3303699) | 3303699..3304118 | - | 420 | WP_158149558.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NYF24_RS15615 (3304145) | 3304145..3304324 | - | 180 | WP_158149559.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NYF24_RS15620 (3304507) | 3304507..3305931 | - | 1425 | WP_010253950.1 | dihydrolipoyl dehydrogenase | - |
| NYF24_RS15625 (3306092) | 3306092..3307993 | - | 1902 | WP_010671838.1 | pyruvate dehydrogenase complex dihydrolipoyllysine-residue acetyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 60 a.a. Molecular weight: 6581.67 Da Isoelectric Point: 10.7838
>T254997 WP_158149559.1 NZ_CP103401:c3304324-3304145 [Pantoea agglomerans]
MDSSTLISEMKADGWVLTRIDGSHHHFTHPTKPGLVTIPHPKKDLPIGTVKSIRKQARI
MDSSTLISEMKADGWVLTRIDGSHHHFTHPTKPGLVTIPHPKKDLPIGTVKSIRKQARI
Download Length: 180 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15166.29 Da Isoelectric Point: 4.6215
>AT254997 WP_158149558.1 NZ_CP103401:c3304118-3303699 [Pantoea agglomerans]
MFYPIAIEAGDHEHAYGVIVPDLPGCFSAGDTLDEAIKNAKEAITGHIELCVELGHEIPAVSTIETLATNPDYQGYIWAL
VDVDVIRLLGGSEKINVTLPRSLIDRIDRCVASHPEYKSRSGFLAQVALERITAPINRP
MFYPIAIEAGDHEHAYGVIVPDLPGCFSAGDTLDEAIKNAKEAITGHIELCVELGHEIPAVSTIETLATNPDYQGYIWAL
VDVDVIRLLGGSEKINVTLPRSLIDRIDRCVASHPEYKSRSGFLAQVALERITAPINRP
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|